Dbfetch

ID   AJ506201; SV 1; linear; genomic DNA; STD; HUM; 226 BP.
XX
AC   AJ506201;
XX
DT   28-AUG-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene MHC class II antigen, HLA-DRB1*1433
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*1433 allele; human leucocyte antigen D;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-226
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (23-AUG-2002) to the INSDC.
RL   Anholts J.D.H., Immunohematology and Bloodtransfusion, Leids Universitair
RL   Medisch Centrum, Albinusdreef 2, 2333 ZA Leiden, NETHERLANDS.
XX
RN   [2]
RA   Anholts J.D.H.;
RT   "Four new HLA alleles found, and conformation of one Class I and two Class
RT   II alleles";
RL   Thesis (2002), Department of Immunohematology and Bloodtransfusion,
RL   University Hospital of Leiden, Leiden, Netherlands.
XX
DR   MD5; dd31b337268351aa591566e19931d0d6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..226
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>226
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1422"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8MGY3"
FT                   /db_xref="IMGT/HLA:DRB1*14:33"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MGY3"
FT                   /protein_id="CAD44639.1"
FT                   /translation="ECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVTELGRPDA
FT                   EYWNSQKDLLEQRRAEVDTYCRHNYGVVES"
FT   exon            1..226
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1422"
FT                   /number=2
XX
SQ   Sequence 226 BP; 49 A; 53 C; 86 G; 38 T; 0 other;
     tgagtgtcat ttcttcaatg ggacggagcg ggtgcggttc ctggacagat acttccataa        60
     ccaggaggag aacgtgcgct tcgacagcga cgtgggggag ttccgggcgg tgacggagct       120
     ggggcggcct gatgccgagt actggaacag ccagaaggac ctcctggagc agaggcgggc       180
     cgaggtggac acctactgca gacacaacta cggggttgtg gagagc                      226
//