spacer

EBI Dbfetch

ID   AJ506200; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ506200;
XX
DT   28-AUG-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*03 allele,
DE   exon 2 and joined CDS
XX
KW   HLA-A gene; HLA-A*03 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (22-AUG-2002) to the INSDC.
RL   Anholts J.D.H., Immunohematology and Bloodbank, Leids Universitair Medisch
RL   Centrum, Albinusdreef 2, 2333 ZA Leiden, NETHERLANDS.
XX
RN   [2]
RA   Anholts J.D.H.;
RT   "Four new HLA alleles found, and conformation of one Class I and two Class
RT   II alleles";
RL   Thesis (2002), Department of Immunohematology and Bloodtransfusion,
RL   University Hospital of Leiden, Leiden, Netherlands.
XX
DR   MD5; b188c06941e2955b64e1639f4730bd32.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ506193.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8MHM2"
FT                   /db_xref="IMGT/HLA:A*03:10"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MHM2"
FT                   /protein_id="CAD44643.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGS
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03"
FT                   /number=2
XX
SQ   Sequence 270 BP; 52 A; 83 C; 97 G; 38 T; 0 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer