spacer

EBI Dbfetch

ID   AJ506181; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   AJ506181;
XX
DT   10-SEP-2002 (Rel. 73, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*24new
DE   allele, exons 2-3
XX
KW   HLA-A gene; HLA-A*24new allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RA   Witter K.;
RT   ;
RL   Submitted (22-AUG-2002) to the INSDC.
RL   Witter K., Laboratory of Immunogenetics, University Munich, Paul-Heyse
RL   Strasse 33, 80336 Munich, GERMANY.
XX
RN   [2]
RA   Witter K., Lau M., Albert E.D.;
RT   "A novel HLA-A*24 allele detected working at the international Terasaki
RT   Cell exchange for HLA Class I quality control";
RL   Unpublished.
XX
DR   MD5; 57cf8f923b3cbaf4e90c5b0562f87fd4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="Ter 1132"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,512..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8HWQ2"
FT                   /db_xref="IMGT/HLA:A*24:37"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWQ2"
FT                   /protein_id="CAD45434.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   LRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRT"
FT   exon            <1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=2
FT   intron          271..511
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=2
FT   exon            512..>787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=3
XX
SQ   Sequence 787 BP; 145 A; 252 C; 281 G; 109 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagctg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctca tcccccacgg acgggccggg tcgcccacag tctccgggtc cgagatccac       360
     cccgaagccg cgggaccccg agacccttgc cccgggagag gcccaggcgc cttaacccgg       420
     tttcattttc agtttaggcc aaaaatcccc ccgggttggt cggggccggg cggggctcgg       480
     gggactgggc tgaccgcggg gtcggggcca ggttctcaca ccctccagat gatgtttggc       540
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       600
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcggct       660
     cagatcacca agcgcaagtg ggaggcggcc catgtggcgg agcagcagag agcctacctg       720
     gagggcacgt gcgtggacgg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//


spacer
spacer