spacer

EBI Dbfetch

ID   AJ506045; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ506045;
XX
DT   22-AUG-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*51 allele,
DE   exon 2 and joined CDS
XX
KW   HLA-B gene; HLB*51 allele; human leucocyte antigen B;
KW   major histocompatability complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Dormoy A.;
RT   ;
RL   Submitted (20-AUG-2002) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Boudifa A.;
RT   "A new B*51 allele identical to the B*51011 current allele except a point
RT   mutation at position 872 of exon 4";
RL   Unpublished.
XX
DR   MD5; 36f4d0dfd129d13cf958dd848a3ffe80.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="INA FA"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ506052.1:1..276,AJ506054.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8MHM6"
FT                   /db_xref="IMGT/HLA:B*51:32"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MHM6"
FT                   /protein_id="CAD44567.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLLKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51"
FT                   /number=2
XX
SQ   Sequence 270 BP; 60 A; 88 C; 84 G; 38 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcattgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer