spacer

EBI Dbfetch

ID   AJ505554; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ505554;
XX
DT   15-AUG-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*51014 allele, exon 4
DE   and joined CDS
XX
KW   HLA-B gene; HLA-B*51014 allele; human leucocyte antigen B;
KW   major histocompatibitly complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Dunn P.P.;
RT   ;
RL   Submitted (09-AUG-2002) to the INSDC.
RL   Dunn P.P., H & I DNA Reference Laboratory, National Blood Service,
RL   Southmead Road, Bristol, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Bowerman C.J., Dunn P.P., Younie M.;
RT   "Nucleotide sequence of a new HLA-B*51014 allele";
RL   Unpublished.
XX
DR   MD5; dfff61cba5ef2a9f2ab0809f649678ff.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..276,AJ505555.1:1..>117)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51014"
FT   CDS             join(<1..276,AJ505555.1:1..>117)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51014"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*51:01:04"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MHM7"
FT                   /protein_id="CAD44162.2"
FT                   /translation="PPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTIPIVGI
FT                   VAGLAVLAVVVIGAVVATVMCRRKSS"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51014"
FT                   /number=4
XX
SQ   Sequence 276 BP; 67 A; 84 C; 83 G; 42 T; 0 other;
     accccccaaa gacacacgtg acccaccacc ccgtctctga ccatgaggcc accctgaggt        60
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggcgagg       120
     accaaactca ggacactgag cttgtggaga ccagaccagc aggagataga accttccaga       180
     agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacatgc catgtacagc       240
     atgaggggct gccgaagccc ctcaccctga gatggg                                 276
//


spacer
spacer