spacer

EBI Dbfetch

ID   AJ505129; SV 1; linear; genomic DNA; STD; HUM; 333 BP.
XX
AC   AJ505129;
XX
DT   14-AUG-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*27 allele
DE   exon 2 and joined CDS
XX
KW   HLA-B gene; HLA-B*27 allele; human leucocyte antigen B;
KW   major histocompatability complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-333
RA   Bengtsson M.;
RT   ;
RL   Submitted (06-AUG-2002) to the INSDC.
RL   Bengtsson M., Dept of Clinical Immunology, Rudbeck Laboratory, University
RL   Hospital, S-751 85 Uppsala, SWEDEN.
XX
RN   [2]
RA   Bengtsson M.;
RT   "HLA B*27 variant";
RL   Unpublished.
XX
DR   MD5; bb22f6756e9425dfef01eb86e78a5ac5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..333
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<56..325,AJ505130.1:4..>279)
FT                   /gene="HLA-B"
FT   CDS             join(<56..325,AJ505130.1:4..>279)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8MHM8"
FT                   /db_xref="IMGT/HLA:B*27:05:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MHM8"
FT                   /protein_id="CAD43645.4"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGP
FT                   DGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            56..325
FT                   /gene="HLA-B"
FT                   /number=2
XX
SQ   Sequence 333 BP; 61 A; 109 C; 119 G; 44 T; 0 other;
     gccgcgccgg gcaggcagga gggtcgggcg ggtctcagcc cctcctcgcc cccaggctcc        60
     cactccatga ggtatttcca cacctccgtg tcccggcctg gccgcgggga gccccgcttc       120
     atcaccgtgg gctacgtgga cgacacgctg ttcgtgaggt tcgacagcga cgccgcgagt       180
     ccgagagagg agccgcgggc gccgtggata gagcaggagg ggccggagta ttgggaccgg       240
     gagacacaga tctgcaaggc caaggcacag actgaccgag aggacctgcg gaccctgctc       300
     cgctactaca accagagcga ggccggtgag tga                                    333
//


spacer
spacer