Dbfetch

ID   AJ505010; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ505010;
XX
DT   12-AUG-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*18011KAB allele,
DE   exon 2 and joined CDS
XX
KW   HLA-B gene; HLA-B*18011KAB allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Blasczyk R.;
RT   ;
RL   Submitted (06-AUG-2002) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RX   DOI; 10.1038/sj.gene.6363981.
RX   PUBMED; 12944976.
RA   Elsner H.A., Baengeroth K., Blasczyk R.;
RT   "The nature of introns 4-6 suggests reduced lineage specificity in HLA-B
RT   alleles";
RL   Genes Immun. 4(6):391-401(2003).
XX
RN   [3]
RA   Baengeroth K.;
RT   ;
RL   Thesis (2002), Department of Transfusion Medicine, Hannover Medical School,
RL   Hannover, Germany.
XX
DR   MD5; bf7bdf672939d1f98750647d48743d29.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="MHH 997560"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /cell_line="GAZI1948"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ505011.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18011KAB"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8MHM9"
FT                   /db_xref="IMGT/HLA:B*18:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MHM9"
FT                   /protein_id="CAD43721.2"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18011KAB"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 90 C; 86 G; 36 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacggca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccgt ggatagagca agaggggccg gagtattggg       180
     accggaacac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//