spacer

EBI Dbfetch

ID   AJ504800; SV 1; linear; genomic DNA; STD; HUM; 73 BP.
XX
AC   AJ504800;
XX
DT   02-AUG-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, isolate 15183,
DE   exon 1 and joined CDS
XX
KW   HLA-B gene; human leucocyte antigen B; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-73
RA   Van den Berg-Loonen E.M.;
RT   ;
RL   Submitted (02-AUG-2002) to the INSDC.
RL   Van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS.
XX
RN   [2]
RA   Voorter C.E., Van den Berg-Loonen E.M.;
RT   "Detection of new HLA B alleles by sequence based typing";
RL   Unpublished.
XX
DR   MD5; 5bdfb61080e74a715a5535837bd98d30.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..73
FT                   /organism="Homo sapiens"
FT                   /isolate="15183"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..73,AJ504801.1:1..270,AJ504802.1:1..>276)
FT                   /gene="HLA-B"
FT   CDS             join(1..73,AJ504801.1:1..270,AJ504802.1:1..>276)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q7YP33"
FT                   /db_xref="IMGT/HLA:B*15:103"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YP33"
FT                   /protein_id="CAD43303.2"
FT                   /translation="MRVTAPRTVLLLLSGALAPTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLENGKETLQRA"
FT   exon            1..73
FT                   /gene="HLA-B"
FT                   /number=1
XX
SQ   Sequence 73 BP; 8 A; 31 C; 24 G; 10 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct cgggagccct ggccccgacc        60
     gagacctggg ccg                                                           73
//


spacer
spacer