spacer

EBI Dbfetch

ID   AJ496552; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ496552;
XX
DT   25-OCT-2002 (Rel. 73, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*13 allele,
DE   exon 3
XX
KW   HLA-B gene; HLA-B*13 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Poli F.;
RT   ;
RL   Submitted (24-JUL-2002) to the INSDC.
RL   Poli F., C.T.I.T, Ospedale Maggiore Policlinico di Milano, Via Francesco
RL   Sforza, 35 - Milano, 20122, ITALY.
XX
RN   [2]
RA   Poli F., Longhi E., Frison S.;
RT   "Identification of a new HLA-B*13 by SBT";
RL   Unpublished.
XX
DR   MD5; 1209d6c89b660e9fc76fea88a4c20e0f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8HWQ4"
FT                   /db_xref="IMGT/HLA:B*13:11"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWQ4"
FT                   /protein_id="CAD43055.1"
FT                   /translation="SHTLQRMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQLKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRA"
FT   exon            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13"
FT                   /number=3
XX
SQ   Sequence 276 BP; 54 A; 85 C; 101 G; 36 T; 0 other;
     ggtctcacac cctccagagg atgtacggct gcgacctggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagttagcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac accgcggctc agatcaccca gctcaagtgg gaggcggccc       180
     gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer