spacer

EBI Dbfetch

ID   AJ496316; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ496316;
XX
DT   22-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*1507 allele,
DE   exon 2
XX
KW   HLA-B gene; HLA-B*1403 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Gervais T.G.;
RT   ;
RL   Submitted (22-JUL-2002) to the INSDC.
RL   Gervais T.G., Immunohaematology, UCL Cliniques St Luc, Clos
RL   Chapelle-aux-Champs, 30 POBox 3052, Brussels, 1200, BELGIUM.
XX
RN   [2]
RA   Gervais T.G., Auspert R., Latinne D.;
RT   "Confirmatory sequence for HLA-B*1507 gene obtained by sequence based
RT   typing";
RL   Unpublished.
XX
DR   MD5; 7656ac2e85e62e6672c8813119d115ad.
DR   Ensembl-Gn; ENSG00000232126; homo_sapiens.
DR   Ensembl-Tr; ENST00000437866; homo_sapiens.
DR   Ensembl-Tr; ENST00000450871; homo_sapiens.
DR   Ensembl-Tr; ENST00000471639; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="23664"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="B*1507"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q861C4"
FT                   /db_xref="IMGT/HLA:B*15:07:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q861C4"
FT                   /protein_id="CAD42872.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="B*1507"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 88 C; 88 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer