spacer

EBI Dbfetch

ID   AJ491301; SV 2; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ491301;
XX
DT   06-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB*1354
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*1354 allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by author [06-AUG-2002]
RP   1-270
RA   Binder T.M.C.;
RT   ;
RL   Submitted (23-JUN-2002) to the INSDC.
RL   Binder T.M.C., University Hospital Hamburg-Eppendorf, HLA Laboratory,
RL   Transfusion Medicine, Martinistrasse 52, D-20246 Hamburg, GERMANY.
XX
RN   [2]
RA   Binder T.M.C., Eiermann T.H.;
RT   "A new HLA-DRB1*1354 allele, found in a Turkish potential stem cell donor
RT   (SCD).";
RL   Unpublished.
XX
DR   MD5; 3c11c0c7b576f52539161d8f8aa6d2bb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Turkey"
FT                   /sex="male"
FT                   /cell_type="B lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1354"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8HWG4"
FT                   /db_xref="IMGT/HLA:DRB1*13:54"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWG4"
FT                   /protein_id="CAD36477.2"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPVAESWNSQKDFLEDERAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1354"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 66 C; 96 G; 53 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacttcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer