spacer

EBI Dbfetch

ID   AJ489936; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ489936;
XX
DT   16-DEC-2002 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*15 allele,
DE   exon 2 and joined CDS, isolate 28580
XX
KW   HLA-B gene; HLA-B*15 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Gervais T.G.;
RT   ;
RL   Submitted (13-JUN-2002) to the INSDC.
RL   Gervais T.G., Immunohaematology, UCL Cliniques St Luc, Clos
RL   Chapelle-aux-Champs, 30 PO Box 3052, Brussels, 1200, BELGIUM.
XX
RN   [2]
RA   Gervais T., Auspert R.M., Latinne D.;
RT   "New HLA-B*15 allele identified by sequence-based typing";
RL   Unpublished.
XX
DR   MD5; 7656ac2e85e62e6672c8813119d115ad.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="28580"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,AJ489937.1:1..>276)
FT   CDS             join(<1..270,AJ489937.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8HWL4"
FT                   /db_xref="IMGT/HLA:B*15:73"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWL4"
FT                   /protein_id="CAD34593.2"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 88 C; 88 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer