spacer

EBI Dbfetch

ID   AJ488066; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   AJ488066;
XX
DT   23-SEP-2002 (Rel. 73, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*13
DE   variant allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*13 variant allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   Poli F.;
RT   ;
RL   Submitted (22-MAY-2002) to the INSDC.
RL   Poli F., C.T.I.T, Ospedale Maggiore Policlinico di Milano, Via Francesco
RL   Sforza, 35 - Milano, 20122, ITALY.
XX
RN   [2]
RA   Poli F., Longhi E., Frison S.;
RT   "Identification of a new HLA DRB1*13 by SBT";
RL   Unpublished.
XX
DR   MD5; 2577e55ee65a3aa8d9551fff88485263.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /tissue_type="peripheral blood"
FT                   /note="caucasoid"
FT                   /db_xref="taxon:9606"
FT   exon            1..264
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13 variant"
FT                   /number=2
FT   CDS             <1..>264
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13 variant"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:53"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="CAD32373.1"
FT                   /translation="FLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVT
FT                   ELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 264 BP; 58 A; 62 C; 96 G; 48 T; 0 other;
     ttcttggagt actctacgtc tgagtgtcat ttcttcaatg ggacggagcg ggtgcggttc        60
     ctggagagat acttccataa ccaggaggag aacgtgcgct tcgacagcga cgtgggggag       120
     taccgggcgg tgacggagct ggggcggcct gatgccgagt actggaacag ccagaaggac       180
     atcctggaag acgagcgggc cgcggtggac acctactgca gacacaacta cggggttgtg       240
     gagagcttca cagtgcagcg gcga                                              264
//


spacer
spacer