Dbfetch

ID   AJ458992; SV 1; linear; genomic DNA; STD; HUM; 3385 BP.
XX
AC   AJ458992;
XX
DT   25-JUN-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*4501 allele, exons
DE   1-7
XX
KW   HLA-B gene; HLA-B*4501 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3385
RA   Cox S.T.;
RT   ;
RL   Submitted (25-APR-2002) to the INSDC.
RL   Cox S.T., The Royal Free Hospital, The Anthony Nolan Research Institute,
RL   Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Confirmation of B*4501";
RL   Unpublished.
XX
DR   MD5; 9c0bd021b5e4bfad1dbd2bc5efff8e1e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3385
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="OMW"
FT                   /db_xref="taxon:9606"
FT   CDS             join(302..374,503..772,1023..1298,1872..2147,2252..2368,
FT                   2810..2842,2949..2992)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /product="HLA-B"
FT                   /function="antigen presentation molecule"
FT                   /db_xref="GOA:P30483"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*45:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30483"
FT                   /protein_id="CAD30340.1"
FT                   /translation="MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTWQRMYGCDLGPDGRLLRGYNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            302..374
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /number=1
FT   intron          375..502
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /number=1
FT   exon            503..772
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /number=2
FT   intron          773..1022
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /number=2
FT   exon            1023..1298
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /number=3
FT   intron          1299..1871
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /number=3
FT   exon            1872..2147
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /number=4
FT   intron          2148..2251
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /number=4
FT   exon            2252..2368
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /number=5
FT   intron          2369..2809
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /number=5
FT   exon            2810..2842
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /number=6
FT   intron          2843..2948
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /number=6
FT   exon            2949..2992
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /number=7
XX
SQ   Sequence 3385 BP; 625 A; 985 C; 1066 G; 709 T; 0 other;
     tggtgtagga gaagagggat caggacgaag tcccaggccc cgggcggggc tctcagggtc        60
     tcaggctccg agggccgcgt ctgcaatggg gaggcgcagc gttggggatt ccccactccc       120
     acgagtttca cttcttctcc caacctatgt cgggtccttc ttccaggata ctcgtgacgc       180
     gtccccattt cccactccca ttgggtgtcg ggtgtctaga gaagccaatc agcgtcgccg       240
     tggtcccagt tctaaagtcc ccacgcaccc acccggactc agaatctcct cagacgccga       300
     gatgcgggtc acggcacccc gaaccgtcct cctgctgctc tcggcggccc tggccctgac       360
     cgagacctgg gccggtgagt gcgggtcggc agggaaatgg cctctgtggg gaggagcgag       420
     gggaccgcag gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt       480
     ctcagcccct cctcgccccc aggctcccac tccatgaggt atttccacac cgccatgtcc       540
     cggcccggcc gcggggagcc ccgcttcatc accgtgggct acgtggacga cacgctgttc       600
     gtgaggttcg acagcgacgc cacgagtccg aggaaggagc cgcgggcgcc atggatagag       660
     caggaggggc cggagtattg ggaccgggag acacagatct ccaagaccaa cacacagact       720
     taccgagaga gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga       780
     ccccggcccg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       840
     agtctccggg tccgagatcc gcccccctga ggccgcggga cccgcccaga ccctcgaccg       900
     gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg       960
     gttggtcggg gcggggcggg gcggggctcg ggggacgggg ctgaccgcgg ggcctgggcc      1020
     agggtctcac acttggcaga ggatgtatgg ctgcgacctg gggcccgacg ggcgcctcct      1080
     ccgcgggtat aaccagttag cctacgacgg caaggattac atcgccctga acgaggacct      1140
     gagctcctgg accgcggcgg acaccgcggc tcagatcacc cagcgcaagt gggaggcggc      1200
     ccgtgtggcg gagcaggaca gagcctacct ggagggcctg tgcgtggagt cgctccgcag      1260
     atacctggag aacgggaagg agacgctgca gcgcgcgggt accaggggca gtggggagcc      1320
     ttccccatct cctataggtc gccggggatg gcctcccacg agaagaggag gaaaatggga      1380
     tcagcgctag aatgtcgccc tcccttgaat ggagaatggc atgagttttc ctgagtttcc      1440
     tctgagggcc ccctcttctc tctaggacaa taaggaatga cgtctctgag gaaatggagg      1500
     ggaagacagt ccctagaata ctgatcaggg gtcccctttg acccctgcag cagccttggg      1560
     aaccgtgact ttcctctcag gccttgttct ctgcctcaca ctcagtgtgt ttggggctct      1620
     gattccagca cttctgagtc actttacctc cactcagatc gggagcagaa gtccctgttc      1680
     cccgctcaga gactcgaact ttccaatgaa taggagatta tcccaggtgc ctgcgtccag      1740
     gctggtgtct gggttctgtg ccccttcccc accccaggtg tcctgtccat tctcaggctg      1800
     gtcacatggg tggtcctagg gtgtcccatg agagatgcaa agcgcctgaa ttttctgact      1860
     cttcccatca gaccccccaa agacacatgt gacccaccac cccatctctg accatgaggc      1920
     caccctgagg tgctgggccc tgggcttcta ccctgcggag atcacactga cctggcagcg      1980
     ggatggcgag gaccaaactc aggacaccga gcttgtggag accagaccag caggagatag      2040
     aaccttccag aagtgggcag ctgtggtggt gccttctgga gaagagcaga gatacacatg      2100
     ccatgtacag catgaggggc tgccgaagcc cctcaccctg agatggggta aggaggggga      2160
     tgaggggtca tatctgttct cagggaaagc aggagccctt ctggagccct tcagcagggt      2220
     cagggcccct catcttcccc tcctttccca gagccatctt cccagtccac catccccatc      2280
     gtgggcattg ttgctggcct ggctgtccta gcagttgtgg tcatcggagc tgtggtcgct      2340
     actgtgatgt gtaggaggaa gagctcaggt agggaagggg tgaggggtgg ggtctgggtt      2400
     ttcttgtccc actgggggtt tcaagcccca ggtagaagtg ttccctgcct cattactggg      2460
     aagcagcatc cacacagggg ctaacgcagc ctgggaccct gtgtgccagc acttactctt      2520
     ttgtgcagca catgtgacaa tgaaggacgg atgtatcgcc ttgatggttg tggtgttggg      2580
     gtcctgattc cagcattcat gagtcagggg aaggtccctg ctaaggacag accttaggag      2640
     ggcagttggt ccaggaccca cacttgcttt cctcgtgttt cctgatcctg ccttgggtct      2700
     gtagtcatac ttctggaaat tccttttggt tccaagacga ggaggttcct ctaagatctc      2760
     atggccctgc ttcctcccag tcccctcaca ggacattttc ttcccacagg tggaaaagga      2820
     gggagctact ctcaggctgc gtgtaagtgg tgggggtggg agtgtggagg agctcaccca      2880
     ccccataatt cctcctgtcc cacgtctcct gagggctctg accaggtcct gtttttgttc      2940
     tactccagcc agcgacagtg cccagggctc tgatgtgtct ctcacagctt gaaaaggtga      3000
     gattcttggg gtctagagtg ggtggggtgg cgggtctggg ggtgggtggg gcagtgggga      3060
     aaggcctggg taatggagat tctttgattg ggatgtttcg cgtgtgtggt gggctgttca      3120
     gagtgtcatc acttaccatg actaaccaga atttgttcat gactgttgtt ttctgtagcc      3180
     tgagacagct gtcttgtgag ggactgagat gcaggatttc ttcacgcctc ccctttgtga      3240
     cttcaagagc ctctggcatc tctttctgca aaggcacctg aatgtgtctg cgtccctgtt      3300
     agcataatgt gaggaggtgg agagacagcc cacccttgtg tccactgtga cccctgttcg      3360
     catgctgacc tgtgtttcct cccca                                            3385
//