spacer

EBI Dbfetch

ID   AJ458991; SV 3; linear; genomic DNA; STD; HUM; 3384 BP.
XX
AC   AJ458991;
XX
DT   25-JUN-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*5701 allele, exons
DE   1-7
XX
KW   HLA-B gene; HLA-B*5701 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Cox S.T.;
RT   ;
RL   Submitted (25-APR-2002) to the INSDC.
RL   Cox S.T., The Royal Free Hospital, The Anthony Nolan Research Institute,
RL   Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Confirmation of B*5701";
RL   Unpublished.
XX
RN   [3]
RC   revised by [4]
RA   Cox S.T.;
RT   ;
RL   Submitted (20-MAY-2003) to the INSDC.
RL   Cox S.T., The Royal Free Hospital, The Anthony Nolan Research Institute,
RL   Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [4]
RP   1-3384
RA   Cox S.T.;
RT   ;
RL   Submitted (03-DEC-2004) to the INSDC.
RL   Cox S.T., The Royal Free Hospital, The Anthony Nolan Research Institute,
RL   Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
DR   MD5; d8eeccef87c1976e8e8f06937b17ae2e.
DR   Ensembl-Gn; ENSG00000224608; homo_sapiens.
DR   Ensembl-Tr; ENST00000435618; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3384
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="MOLT-4"
FT                   /db_xref="taxon:9606"
FT   CDS             join(302..374,503..772,1019..1294,1870..2145,2250..2366,
FT                   2808..2840,2947..2990)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation molecule"
FT                   /db_xref="GOA:P18465"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*57:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:2BVO"
FT                   /db_xref="PDB:2BVP"
FT                   /db_xref="PDB:2BVQ"
FT                   /db_xref="PDB:2HJL"
FT                   /db_xref="PDB:2RFX"
FT                   /db_xref="PDB:2YPK"
FT                   /db_xref="PDB:2YPL"
FT                   /db_xref="PDB:3UPR"
FT                   /db_xref="PDB:3VH8"
FT                   /db_xref="PDB:3VRI"
FT                   /db_xref="PDB:3VRJ"
FT                   /db_xref="PDB:3WUW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18465"
FT                   /protein_id="CAD30339.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRI
FT                   ALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            302..374
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /number=1
FT   intron          375..502
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /number=1
FT   exon            503..772
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /number=2
FT   intron          773..1018
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /number=2
FT   exon            1019..1294
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /number=3
FT   intron          1295..1869
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /number=3
FT   exon            1870..2145
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /number=4
FT   intron          2146..2249
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /number=4
FT   exon            2250..2366
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /number=5
FT   intron          2367..2807
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /number=5
FT   exon            2808..2840
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /number=6
FT   intron          2841..2946
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /number=6
FT   exon            2947..2990
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5701"
FT                   /number=7
XX
SQ   Sequence 3384 BP; 622 A; 985 C; 1068 G; 709 T; 0 other;
     tggtgtagga gaagagggat caggacgaag tcccaggtcc cggacggggc tctcagggtc        60
     tcaggctccg agagccttgt ctgcattggg gaggcgcagc gttggggatt ccccactccc       120
     acgagtttca cttcttctcc caacctgtgt cgggtccttc ttccaggata ctcgtgacgc       180
     gtccccattt cccactccca ttgggtgtcg ggtgtctaga gaagccaatc agcgtcgccg       240
     cggtcccagt tctaaagtcc ccacgcaccc acccggactc agaatctcct cagacgccga       300
     gatgcgggtc acggcacccc gaaccgtcct cctgctgctc tggggggcag tggccctgac       360
     cgagacctgg gccggtgagt gcgggtcggc agggaaatgg cctctgtagg gaggagcaag       420
     gggaccgcag gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt       480
     ctcagcccct cctcgccccc aggctcccac tccatgaggt atttctacac cgccatgtcc       540
     cggcccggcc gcggggagcc ccgcttcatc gcagtgggct acgtggacga cacccagttc       600
     gtgaggttcg acagcgacgc cgcgagtccg aggatggcgc cccgggcgcc atggatagag       660
     caggaggggc cggagtattg ggacggggag acacggaaca tgaaggcctc cgcgcagact       720
     taccgagaga acctgcggat cgcgctccgc tactacaacc agagcgaggc cggtgagtga       780
     ccccggcccg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       840
     agtctccggg tccgagatcc acccccctga ggccgcggga cccgcccaga ccctcgaccg       900
     gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg       960
     gttggtcagg gcggggcggg gctcgggggg acggggctga ccgcggggcc ggggccaggg      1020
     tctcacatca tccaggtgat gtatggctgc gacgtggggc cggacgggcg cctcctccgc      1080
     gggcatgacc agtccgccta cgacggcaag gattacatcg ccctgaacga ggacctgagc      1140
     tcctggaccg cggcggacac ggcggctcag atcacccagc gcaagtggga ggcggcccgt      1200
     gtggcggagc agctgagagc ctacctggag ggcctgtgcg tggagtggct ccgcagatac      1260
     ctggagaacg ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc      1320
     ccatctccta taggtcgccg gggatggcct cccacgagaa gaggaggaaa atgggatcag      1380
     cgctagaatg tcgccctccc ttgaatggag aatggcatga gttttcctga gtttcctctg      1440
     agggccccct cttctctcta ggacaattaa gggatgacgt ctctgaggaa atggagggga      1500
     agacagtccc tagaatactg atcaggggtc ccctttgacc cctgcagcag ccttgggaac      1560
     cgtgactttt cctctcaggc cttgttctct gcctcacact cagtgtgttt ggggctctga      1620
     ttccagcact tctgagtcac tttacctcca ctcagatcag gagcagaagt ccctgttccc      1680
     cgctcagaga ctcgaacttt ccaatgaata ggagattatc ccaggtgcct gcgtccaggc      1740
     tggtgtctgg gttctgtgcc ccttccccac cccaggtgtc ctgcccattc tcaggctggt      1800
     cacatgggtg gtcctagggt gtcccatgag agatgcaaag cgcctgaatt ttctgactct      1860
     tcccatcaga ccccccaaag acacatgtga cccaccaccc catctctgac catgaggcca      1920
     ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1980
     atggcgagga ccaaactcag gacaccgagc ttgtggagac cagaccagca ggagatagaa      2040
     ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga tacacatgcc      2100
     atgtacagca tgaggggctg ccaaagcccc tcaccctgag atggggtaag gagggggatg      2160
     aggggtcata tctcttctca gggaaagcag gagcccttct ggagcccttc agcagggtca      2220
     gggcccctca tcttcccctc ctttcccaga gccatcttcc caatccaccg tccccatcgt      2280
     gggcattgtt gctggcctgg ctgtcctagc agttgtggtc atcggagctg tggtcgctgc      2340
     tgtgatgtgt aggaggaaga gctcaggtag ggaaggggtg aggggtgggg tctgggtttt      2400
     cttgtcccac tgggggtttc aagccccagg tagaagtgtt ccctgcctca ttactgggaa      2460
     gcagcatgca cacaggggct aacgcagcct gggaccctgt gtgccagcac ttactctttt      2520
     gtgcagcaca tgtgacaatg aaggacggat gtatcacctc gatggttgtg gtgttggggt      2580
     cctgattcca gcattcatga gtcaggggaa ggtccctgct aaggacagac cttaggagag      2640
     cagttggtcc aggacccaca cttgctttcc tcgtgtttcc tgatcctgcc ctgggtctgt      2700
     agtcatactt ctggaaattc cttttgggtc caagacgagg aggttcctct aagatctcat      2760
     ggccctgctt cctcccagtc ccctcacagg acattttctt cccacaggtg gaaaaggagg      2820
     gagctactct caggctgcgt gtaagtggtg ggggtgggag tgtggaggag ctcacccacc      2880
     ccataattcc tcctgtccca cgtctcctgc gggctctgac caggtcctgt ttttgttcta      2940
     ctccaggcag cgacagtgcc cagggctctg atgtgtctct cacagcttga aaaggtgaga      3000
     ttcttggggt ctagagtggg tgggggtggc gggtctgggg cggggtgggg cagaggggaa      3060
     aggcctgggt aatggagatt ctttgattgg gatgtttcgc gtgtgtggtg ggctgttcag      3120
     agtgtcatca cttaccatga ctcaccagaa tttgttcatg actgttgttt tctgtagcct      3180
     gagacagctg tcttgtgagg gactgagatg caggatttct tcacgcctcc cctttgtgac      3240
     ttcaagagcc tctggcatct ctttctgcaa aggcacctga atgtgtctgc gtccctgtta      3300
     gcctaatgtg aggaggtgga gagacagccc aaccttgtgt ccactgtgac ccctgttccc      3360
     atgctgacct gtgtttcctc ccca                                             3384
//


spacer
spacer