spacer

EBI Dbfetch

ID   AJ441130; SV 2; linear; genomic DNA; STD; HUM; 263 BP.
XX
AC   AJ441130;
XX
DT   25-MAY-2002 (Rel. 71, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*07new
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*07new allele human leucocyte antigen DRB1;
KW   major histocompatability complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by author [13-MAY-2002]
RP   1-263
RA   Poli F.;
RT   ;
RL   Submitted (08-APR-2002) to the INSDC.
RL   Poli F., C.T.I.T, Ospedale Maggiore Policlinico di Milano, Via Francesco
RL   Sforza, 35 - Milano, 20122, ITALY.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.2003.00030.x.
RX   PUBMED; 12694577.
RA   Frison S., Poli F., Longhi E., Bianchi P., Marc Baier D., Scalamogna M.;
RT   "A novel HLA-DRB1 allele, DRB1*0707";
RL   Tissue Antigens 61(3):259-260(2003).
XX
DR   MD5; 2eb26accaf35af68f43e0c0c86cea36f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..263
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>263
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*07new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8MHQ0"
FT                   /db_xref="IMGT/HLA:DRB1*07:07"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MHQ0"
FT                   /protein_id="CAD29646.2"
FT                   /translation="LWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAVTE
FT                   LGWPVAESWNSQKDILEDRRGQVDTVCRHNYGVGESFTVQRRV"
FT   variation       163
FT                   /allele="HLA-DRB1*0701"
FT                   /replace="t"
XX
SQ   Sequence 263 BP; 57 A; 59 C; 99 G; 48 T; 0 other;
     ctgtggcagg gtaagtataa gtgtcatttc ttcaacggga cggagcgggt gcagttcctg        60
     gaaagactct tctataacca ggaggagttc gtgcgcttcg acagcgacgt gggggagtac       120
     cgggcggtga cggagctagg gtggcctgtc gccgagtcct ggaacagcca gaaggacatc       180
     ctggaggaca ggcggggcca ggtggacacc gtgtgcagac acaactacgg ggttggtgag       240
     agcttcacag tgcagcggcg agt                                               263
//


spacer
spacer