Dbfetch

ID   AJ440718; SV 1; linear; genomic DNA; STD; HUM; 291 BP.
XX
AC   AJ440718;
XX
DT   04-APR-2002 (Rel. 71, Created)
DT   14-JUL-2009 (Rel. 101, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*05 variant
DE   allele, exon 3
XX
KW   HLA-C gene; HLA-Cw*05 variant allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-291
RA   Bengtsson M.;
RT   ;
RL   Submitted (28-MAR-2002) to the INSDC.
RL   Bengtsson M., Dept of Oncology, Radiology and Clinical, Section of Clinical
RL   Immunology, Rudbeck Laboratory, University Hospital, SE-751 85 Uppsala,
RL   SWEDEN.
XX
RN   [2]
RX   DOI; 10.1111/j.0001-2815.2004.00206.x.
RX   PUBMED; 15140042.
RA   Bengtsson M., Danielsson F., Jansson I.E., Senkas A.;
RT   "Identification of a new HLA-Cw*05 allele, HLA-Cw*0505*";
RL   Tissue Antigens 63(6):600-601(2004).
XX
DR   MD5; 87d3f935a1b2caad07e80144246234db.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..291
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <5..>280
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*05 variant"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8SNA9"
FT                   /db_xref="IMGT/HLA:C*05:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8SNA9"
FT                   /protein_id="CAD29451.1"
FT                   /translation="SHTLQRMYGCDVGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAA
FT                   DKAAQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKKTLQRA"
FT   exon            5..280
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*05 variant"
FT                   /number=3
XX
SQ   Sequence 291 BP; 58 A; 89 C; 107 G; 37 T; 0 other;
     ccagggtctc acaccctcca gaggatgtat ggctgcgacg tggggcccga cgggcgcctc        60
     ctccgcgggt ataaccagtt cgcctacgac ggcaaggatt acatcgccct gaatgaggac       120
     ctgcgctcct ggaccgccgc ggacaaggcg gctcagatca cccagcgcaa gtgggaggcg       180
     gcccgtgagg cggagcagcg gagagcctac ctggagggca cgtgcgtgga gtggctccgc       240
     agatacctgg agaacgggaa gaagacgctg cagcgcgcgg gtaccagggg c                291
//