spacer

EBI Dbfetch

ID   AJ440717; SV 1; linear; genomic DNA; STD; HUM; 301 BP.
XX
AC   AJ440717;
XX
DT   04-APR-2002 (Rel. 71, Created)
DT   14-JUL-2009 (Rel. 101, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*05 variant
DE   allele, exon 2
XX
KW   HLA-C gene; HLA-Cw*05 variant allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-301
RA   Bengtsson M.;
RT   ;
RL   Submitted (28-MAR-2002) to the INSDC.
RL   Bengtsson M., Dept of Oncology, Radiology and Clinical, Section of Clinical
RL   Immunology, Rudbeck Laboratory, University Hospital, SE-751 85 Uppsala,
RL   SWEDEN.
XX
RN   [2]
RX   DOI; 10.1111/j.0001-2815.2004.00206.x.
RX   PUBMED; 15140042.
RA   Bengtsson M., Danielsson F., Jansson I.E., Senkas A.;
RT   "Identification of a new HLA-Cw*05 allele, HLA-Cw*0505*";
RL   Tissue Antigens 63(6):600-601(2004).
XX
DR   MD5; bf4b6ed2bf717c73b610a000fade9f07.
DR   Ensembl-Gn; ENSG00000206435; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206452; homo_sapiens.
DR   Ensembl-Tr; ENST00000383323; homo_sapiens.
DR   Ensembl-Tr; ENST00000383483; homo_sapiens.
DR   Ensembl-Tr; ENST00000383487; homo_sapiens.
DR   Ensembl-Tr; ENST00000400341; homo_sapiens.
DR   Ensembl-Tr; ENST00000400394; homo_sapiens.
DR   Ensembl-Tr; ENST00000400395; homo_sapiens.
DR   Ensembl-Tr; ENST00000434884; homo_sapiens.
DR   Ensembl-Tr; ENST00000448362; homo_sapiens.
DR   Ensembl-Tr; ENST00000449884; homo_sapiens.
DR   Ensembl-Tr; ENST00000458668; homo_sapiens.
DR   Ensembl-Tr; ENST00000461937; homo_sapiens.
DR   Ensembl-Tr; ENST00000469544; homo_sapiens.
DR   Ensembl-Tr; ENST00000485321; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..301
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <16..>285
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*05 variant"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8SNB0"
FT                   /db_xref="IMGT/HLA:C*05:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q8SNB0"
FT                   /protein_id="CAD29450.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEA"
FT   exon            16..285
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*05 variant"
FT                   /number=2
XX
SQ   Sequence 301 BP; 60 A; 99 C; 104 G; 38 T; 0 other;
     cctcctcgcc cccaggctcc cactccatga ggtatttcta caccgccgtg tcccggcccg        60
     gccgcggaga gccccgcttc atcgcagtgg gctacgtgga cgacacgcag ttcgtgcagt       120
     tcgacagcga cgccgcgagt ccaagagggg agccgcgggc gccgtgggtg gagcaggagg       180
     ggccggagta ttgggaccgg gagacacaga agtacaagcg ccaggcacag actgaccgag       240
     tgaacctgcg gaaactgcgc ggctactaca accagagcga ggccggtgag tgacccggcc       300
     c                                                                       301
//


spacer
spacer