Dbfetch

ID   AJ440716; SV 2; linear; mRNA; STD; HUM; 822 BP.
XX
AC   AJ440716;
XX
DT   04-APR-2002 (Rel. 71, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens partial mRNA for MHC class I antigen (HLA-C gene, HLA-Cw*07
DE   allele), exons 2 and 3
XX
KW   HLA-C gene; HLA-Cw*07 allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Chabod J.;
RT   ;
RL   Submitted (28-MAR-2002) to the INSDC.
RL   Chabod J., Immunogenetics, Efsbfc, 1 Bd A. Fleming, 25020 Besancon cedex,
RL   FRANCE.
XX
RN   [2]
RA   Chabod J.;
RT   "Identification of a novel HLA-C*07 allele";
RL   Unpublished.
XX
RN   [3]
RP   1-822
RA   Chabod J.;
RT   ;
RL   Submitted (07-APR-2003) to the INSDC.
RL   Chabod J., Immunogenetics, Efsbfc, 1 Bd A. Fleming, 25020 Besancon cedex,
RL   FRANCE.
XX
DR   MD5; deb1769933353c7b9c9b574df75d5c65.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..822
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>822
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="H-InvDB:HIT000248054.9"
FT                   /db_xref="IMGT/HLA:C*07:20"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q8SNB1"
FT                   /protein_id="CAD29433.2"
FT                   /translation="SHSMRYFDTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSW"
FT   exon            <1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07"
FT                   /number=2
FT   exon            271..539
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07"
FT                   /number=3
XX
SQ   Sequence 822 BP; 169 A; 261 C; 284 G; 108 T; 0 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggggagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaactac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg ggtctcacac cctccagagg atgtatggct       300
     gcgacctggg gcccgacggg cgcctcctcc gcgggtatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac accgcggctc       420
     agatcaccca gcgcaagttg gaggcggccc gtgcggcgga gcagctgaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcagaacc cccaaagaca cacgtgaccc accaccccct ctctgaccat gaggccaccc       600
     tgaggtgctg ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg       660
     gggaggacca gacccaggac accgagcttg tggagaccag gccagcagga gatggaacct       720
     tccagaagtg ggcagctgtg gtggtgcctt ctggacaaga gcagagatac acgtgccata       780
     tgcagcacga ggggctgcaa gagcccctca ccctgagctg gg                          822
//