spacer

EBI Dbfetch

ID   AJ438882; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ438882;
XX
DT   12-MAR-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-Cw gene for MHC class I antigen, HLA-Cw*0801new
DE   allele, exon 2 and joined CDS
XX
KW   HLA-C gene; HLA-Cw*0801new allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Wu S.;
RT   ;
RL   Submitted (12-MAR-2002) to the INSDC.
RL   Wu S., Medical Technology, Tzu Chi University, #701, Chung Yang Rd.,
RL   Section III, Hualien, Taiwan, 970, TAIWAN.
XX
RN   [2]
RA   Wu S.;
RT   "Silent substitution in the beta sheet of HLA-C alpha-2 domain generates a
RT   novel HLA-C allele (HLA-Cw*0801new) in a Puyuma aboriginal individual in
RT   Taiwan";
RL   Unpublished.
XX
DR   MD5; 702417658e4746dc75b8bb2355eee8ac.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="Puyuma aborigine"
FT                   /mol_type="genomic DNA"
FT                   /country="Taiwan:South Taiwan"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /note="Puyuma aborigine from south Taiwan"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ438883.1:1..>275)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0801new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen processing"
FT                   /db_xref="GOA:Q860S4"
FT                   /db_xref="IMGT/HLA:C*08:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q860S4"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAD27616.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARTAEQLRAYLEGTC
FT                   VEWLRRYLENGKKTLQRA"
FT   exon            <1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0801new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 84 C; 97 G; 34 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcagttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer