spacer

EBI Dbfetch

ID   AJ431718; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ431718;
XX
DT   20-AUG-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, DRB1*15022 like
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*15022 like allele; human leucocyte antigen DRB1;
KW   major histocompatability complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Czachurski D.;
RT   ;
RL   Submitted (20-FEB-2002) to the INSDC.
RL   Czachurski D., Department of Transplantation Immunology, University of
RL   Heidelberg, Im Neuenheimer Feld 305, D-69120, GERMANY.
XX
RN   [2]
RA   Czachurski D., Opelz G., Mytilineos J.;
RT   "A new HLA-DRB allele (DRB1*15014) identified in a Caucasian individual";
RL   Hum. Immunol. 64(2):210-313(2003).
XX
DR   MD5; ea891d01e4cafdab2ab3cfae3fe53748.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="ID 24489"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany:Nordbaden"
FT                   /sex="male"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*15022 like"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8MGY6"
FT                   /db_xref="IMGT/HLA:DRB1*15:01:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MGY6"
FT                   /protein_id="CAD24479.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*15022 like"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 66 C; 101 G; 48 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer