spacer

EBI Dbfetch

ID   AJ430557; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AJ430557;
XX
DT   07-JAN-2005 (Rel. 82, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Gerbillurus paeba mitochondrial partial cytb gene for cytochrome b
XX
KW   cytb gene; cytochrome b.
XX
OS   Gerbillurus paeba
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Gerbillinae; Gerbillurus.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Chevret P.D.;
RT   ;
RL   Submitted (11-FEB-2002) to the INSDC.
RL   Chevret P.D., Institut des Sciences de l'Evolution, Laboratoire de
RL   Paleontologie, cc 064, Univ. Montpellier 2, pl. E. Bataillon, 34095
RL   Montpellier cedex 05, FRANCE.
XX
RN   [2]
RA   Chevret P.D.;
RT   "Molecular evidences of a Tatera-Gerbillurus clade to the exclusion of
RT   Taterillus (Gerbillinae: Muridae)";
RL   Unpublished.
XX
DR   MD5; 4d57b53f00fe33d1c6c570c1df63d618.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Gerbillurus paeba"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="South Africa"
FT                   /tissue_lib="T-1074"
FT                   /db_xref="taxon:186476"
FT   CDS             1..>1140
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q5K5D0"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K5D0"
FT                   /protein_id="CAD23162.1"
FT                   /translation="MTNMRKHHPLIKIINNSFIDLPTPPNISSWWNFGSLLGLCLIIQI
FT                   ITGLFLAMHYTADTTTAFSSVSHICRDVNYGWLIRYMHANGASMFFICLFIHIGRGIYY
FT                   GSYLYTETWNIGVILLFSVMGTAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTIVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIILALAAVHLLFLHETGSNNPLGINSNADKIPFHP
FT                   YYSIKDFLGVLVLITLFMVVVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILVLLPLIHTSKQRSLVFRPISQFIFWMLVANLLILTWIGG
FT                   QPVEHPFVLIGQLASISYFSIILIFLPTAGIIENYIFKCY"
XX
SQ   Sequence 1140 BP; 346 A; 273 C; 145 G; 376 T; 0 other;
     atgacaaaca tacgaaaaca tcacccatta attaaaatca ttaataactc attcattgat        60
     ttacctactc cacccaatat ttcatcatga tgaaactttg gatcgctatt aggcctatgc       120
     ttaattattc aaattattac aggcctattt ttagcaatac actatacagc agatacaaca       180
     acagcattct catctgtatc acacatctgc cgagacgtaa actacggctg actaattcgt       240
     tatatacatg caaacggagc ctctatattc tttatctgcc tatttattca cattggacga       300
     gggatttatt acggatctta cctttataca gaaacatgaa atatcggcgt tattctactg       360
     ttctcagtaa taggcacggc ttttataggt tatgtgctcc cgtgaggaca aatgtcattc       420
     tgaggagcaa ctgtcattac aaacctactt tcagccatcc cctatatcgg aacaacaatt       480
     gtagaatgaa tctgaggtgg tttctcagta gataaagcta ccctaacacg cttcttcgca       540
     ttccacttca ttttaccttt tattatttta gctttggcag cagttcatct tttattcctt       600
     catgaaacag gctcaaataa ccccctagga atcaattcaa acgcagacaa aattcctttt       660
     cacccttact actcaatcaa agacttccta ggagtgcttg tactaatcac attatttata       720
     gttgtagtat tattttttcc tgacctatta ggagacccag ataactacac cccagccaac       780
     ccactaaata cacctcccca cattaaacca gagtgatact tccttttcgc ttacgccatc       840
     ctacgttcaa ttcctaataa attaggagga gttctagcct taattctctc cattctcatc       900
     cttgtacttt tacccttaat tcatacatca aaacaacgaa gcctagtatt tcgaccaatc       960
     tctcaattta tcttttgaat attagtagcc aatctcttaa ttctcacatg gattggaggt      1020
     caaccagtag aacacccatt tgttttaatt ggacaactag cctcaatttc ctacttctct      1080
     attatcctaa ttttcctacc caccgcagga attattgaga actatatttt taaatgctat      1140
//


spacer
spacer