spacer

EBI Dbfetch

ID   AJ430528; SV 1; linear; genomic DNA; STD; HUM; 3123 BP.
XX
AC   AJ430528;
XX
DT   09-MAY-2002 (Rel. 71, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, A*68011 variant allele,
DE   exons 1-8
XX
KW   A*68011 allele; HLA-A gene; human leuocyte antigen A;
KW   major histocompatibility complex; MHC class 1 antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3123
RA   Cox S.T.;
RT   ;
RL   Submitted (08-FEB-2002) to the INSDC.
RL   Cox S.T., HLA Sequencing, The Anthony Nolan Research Institute, The Royal
RL   Free Hospital, Pond Street, Hampstead, London NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "New allele HLA-A*68011V";
RL   Unpublished.
XX
DR   MD5; 1fe5abce25a4a998b894207474c1b0d5.
XX
CC   Related sequence: AJ315642 (HLA-A*68011).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3123
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Ireland"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,204..473,715..990,1591..1866,1966..2082,
FT                   2521..2553,2696..2743,2971..2975)
FT                   /gene="HLA-A"
FT                   /allele="A*68011 variant allele"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:Q8MGT5"
FT                   /db_xref="IMGT/HLA:A*68:22"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MGT5"
FT                   /protein_id="CAD23134.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGT
FT                   LHGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   sig_peptide     1..73
FT                   /gene="HLA-A"
FT   exon            1..73
FT                   /gene="HLA-A"
FT                   /number=1
FT   intron          74..203
FT                   /gene="HLA-A"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-A"
FT                   /number=2
FT   intron          474..714
FT                   /gene="HLA-A"
FT                   /number=2
FT   exon            715..990
FT                   /gene="HLA-A"
FT                   /number=3
FT   intron          991..1590
FT                   /gene="HLA-A"
FT                   /number=3
FT   exon            1591..1866
FT                   /gene="HLA-A"
FT                   /number=4
FT   intron          1867..1965
FT                   /gene="HLA-A"
FT                   /number=4
FT   exon            1966..2082
FT                   /gene="HLA-A"
FT                   /number=5
FT   intron          2083..2520
FT                   /gene="HLA-A"
FT                   /number=5
FT   exon            2521..2553
FT                   /gene="HLA-A"
FT                   /number=6
FT   intron          2554..2695
FT                   /gene="HLA-A"
FT                   /number=6
FT   exon            2696..2743
FT                   /gene="HLA-A"
FT                   /number=7
FT   intron          2744..2970
FT                   /gene="HLA-A"
FT                   /number=7
FT   exon            2971..2975
FT                   /gene="HLA-A"
FT                   /number=8
XX
SQ   Sequence 3123 BP; 606 A; 896 C; 960 G; 660 T; 1 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcggg agggaaacgg cctctgtggg gagaagcaag       120
     gggcccgccc ggcgggggcg caggacccgg gaagccgcgc ctggaggagg gtcgggcggg       180
     tctcagccac tcctcgcccc caggctccca ctccatgagg tatttctaca cctccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagggg ccggagtatt gggaccggaa cacacggaat gtgaaggccc agtcacagac       420
     tgaccgagtg gacctgggga ccctgcacgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tcatccccca cggacgggcc aggtcgccca       540
     cagtctccgg gtccgagatc cgccccgaag ccgcgggacc ccgagaccct tgccccggga       600
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       660
     ggtcggggcg gggcggggct cgggggaccg ggctgacctc ggggtccggg ccaggttctc       720
     acaccatcca gatgatgtat ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt       780
     accggcagga cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt       840
     ggaccgcggc ggacatggca gctcagacca ccaagcacaa gtgggaggcg gcccatgtgg       900
     cggagcagtg gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat      1020
     cgcctgtaga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcgc cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1140
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1200
     ctgaaggaat gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacacac      1260
     acaggcagca gccttgggcc cgtgactttt cctctcaggc cttgttctct gcttcacact      1320
     caatgtgtgt gggggtctga gtccagcact tctgagtccc tcagcctcca ctcaggtcag      1380
     gaccagaagt cgctgttccc tcttcaggga ctagaatttt ccacggaata ggagattatc      1440
     ccaggtgcct gtgtccaggc tggtgtctgg gttctgtgct cccttcccca tcccaggtgt      1500
     cctgtccatt ctcaagatag ccacatgtgt gctggaggag tgtcccatga cagatgcaaa      1560
     atgcctgaat gatctgactc ttcctgacag acgcccccaa aacgcatatg actcaccacg      1620
     ctgtctctga ccatgaagcc accctgaggt gctgggccct gagcttctac cctgcggaga      1680
     tcacactgac ctggcagcgg gatggggagg accagaccca ggacacggag ctcgtggaga      1740
     ccaggcctgc aggggatgga accttccaga agtgggtggc tgtggtggtg ccttctggac      1800
     aggagcagag atacacctgc catgtgcagc atgagggttt gcccaagccc ctcaccctga      1860
     gatggggtaa ggagggagac gggggtgtca tgtcttttag ggaaagcagg agcctctctg      1920
     acctttagca gggtcagggc ccctcacctt cccctctttt cccagagccg tcttcccagc      1980
     ccaccatccc catcgtgggc atcattgctg gcctggttct ctttggagct gtgatcactg      2040
     gagctgtggt cgctgctgtg atgtggagga ggaagagctc aggtggggaa ggggtgaagg      2100
     gtgggtctga gatttcttgt ctcactgagg gttccaagac ccaggtagaa gtgtgccctg      2160
     cctcgttact gggaagcacc acccacaatt atgggcctac ccagcctggg ccctgtgtgc      2220
     cagcacttac tcttttgtaa agcacctgtt aaaatgaagg acagatttat caccttgatt      2280
     acagcggtga tgggacctga tcccagcagt cacaagtcac aggggaaggt ccctgaggac      2340
     cttcaggagg gcggttggtc caggacccac acctgctttc ttcatgtttc ctgatcccgc      2400
     cctgggtctg cagtcacaca tttctggaaa cttctctgag gtccaagact tggaggttcc      2460
     tctaggacct taaggccctg actcctttct ggtatctcac aggacatttt cttcccacag      2520
     atagaaaagg agggagctac tctcaggctg caagtaagta tgaaggaggc tgatgcctga      2580
     ggtccttggg atattgtgtt tgggagccca tgggggagct cacccacccc acaattcctc      2640
     ctctagccac atcttctgtg ggatctgacc aggttctgtt tttgttctac cccaggcagt      2700
     gacagtgccc agggctctga tgtgtctctc acagcttgta aaggtgagag cctggagggc      2760
     ctgatgtgtg ttgggtgttg ggcggaacag tggacacagc tgtgctatgg ggtttctttc      2820
     cattggatgt attgagcatg cgatgggctg tttaaagtgt gacccctcac tgtgacagat      2880
     acgaatttgt tcatgaatat ttttttctat agtgtgagac agctgccttg tgtgggactg      2940
     agaggcaaga gttgttcctg cccttccctt tgtgacttga agaaccctga ctttgtttct      3000
     gcaaaggcac ctgcatgtgt ctgtgttcgt gtaggcataa tgtgaggagg tggggagacc      3060
     accccacccc catgtccacc atgaccctct tcccacgctg acctgtgctc cctccccaaa      3120
     atn                                                                    3123
//


spacer
spacer