Dbfetch

ID   AJ430382; SV 1; linear; genomic DNA; STD; HUM; 265 BP.
XX
AC   AJ430382;
XX
DT   08-FEB-2002 (Rel. 70, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, DRB1*01 variant
DE   allele, isolate 376P01
XX
KW   HLA-DRB1 gene; HLA-DRB1*01 variant allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-265
RA   Conte R.;
RT   ;
RL   Submitted (06-FEB-2002) to the INSDC.
RL   Conte R., Ospedale S.Orsola-Malpighi, Servizio Medicina Trasfusionale, Via
RL   Massarenti 9, Bologna, Italy, 40138 Bologna, ITALY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2004.00326.x.
RX   PUBMED; 15496210.
RA   Bontadini A., Manfroi S., Delfino L., Fruet F., Iannelli S., Parodi A.M.,
RA   Parodi G.B., Conte R.;
RT   "Characterization of a new HLA-DRB1*01 allele (HLA-DRB1*010203) in a
RT   Caucasian Italian family by using sequence-based typing";
RL   Tissue Antigens 64(5):624-626(2004).
XX
DR   MD5; dd897cf7d3cb7195cc42d1dbc7b2d395.
XX
CC   Related sequences: AJ558181 (isolate 421P01), AJ558180 (isolate 357P01).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..265
FT                   /organism="Homo sapiens"
FT                   /isolate="376P01"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>265
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*01 variant"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8SP67"
FT                   /db_xref="IMGT/HLA:DRB1*01:02:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8SP67"
FT                   /protein_id="CAD23046.1"
FT                   /translation="FLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVT
FT                   ELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGAVESFTVQRR"
FT   exon            <1..>265
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 265 BP; 56 A; 60 C; 99 G; 50 T; 0 other;
     ttcttgtggc agcttaagtt tgaatgtcat ttcttcaatg ggacggagcg ggtgcggttg        60
     ctggaaagat gcatctataa ccaggaggag tccgtgcgct tcgacagcga cgtgggggag       120
     taccgggcgg tgacggagct ggggcggcct gatgccgagt actggaacag ccagaaggac       180
     ctcctggagc agaggcgggc cgcggtggac acctattgca gacacaacta cggggctgtg       240
     gagagcttca cagtgcagcg gcgag                                             265
//