spacer

EBI Dbfetch

ID   AJ430192; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ430192;
XX
DT   06-FEB-2002 (Rel. 70, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, DRB1*0101
DE   variant allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*0101 variant allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Dunn P.P.J.;
RT   ;
RL   Submitted (05-FEB-2002) to the INSDC.
RL   Dunn P.P.J., H & I DNA Reference Laboratory, National Blood Service,
RL   Southmead Road, Bristol BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Corbett N., Sage D., Dunn P.P.J.;
RT   "Identification of a new HLA-DRB1*01 allele";
RL   Unpublished.
XX
DR   MD5; 3afae0a8037b5056c62184f1b81d66ec.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*0101 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q8SP68"
FT                   /db_xref="IMGT/HLA:DRB1*01:09"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8SP68"
FT                   /protein_id="CAD22866.1"
FT                   /translation="RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQARAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*0101 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 63 C; 99 G; 51 T; 0 other;
     cacgtttctt gtggcagctt aagtttgaat gtcatttctt caatgggacg gagcgggtgc        60
     ggttgctgga aagatgcatc tataaccaag aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer