spacer

EBI Dbfetch

ID   AJ427352; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ427352;
XX
DT   08-JAN-2002 (Rel. 70, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB5 gene MHC class II antigen, variant allele,
DE   exon 2
XX
KW   HLA-DRB5 gene; HLA-DRB5* variant allele; human leucocyte antigen DRB5;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Dunn P.P.J.;
RT   ;
RL   Submitted (07-JAN-2002) to the INSDC.
RL   Dunn P.P.J., H & I DNA Reference Laboratory, National Blood Service,
RL   Southmead Road, Bristol BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Dunn P.P.J., Jobson S.;
RT   "Nucleotide sequence of an HLA-DRB5* allele";
RL   Unpublished.
XX
DR   MD5; 8e7a5d085a658d440af0ab496fa115e8.
DR   Ensembl-Gn; ENSG00000198502; homo_sapiens.
DR   Ensembl-Tr; ENST00000374975; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            1..270
FT                   /gene="HLA-DRB5"
FT                   /allele="HLA-DRB5* variant"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB5"
FT                   /allele="HLA-DRB5* variant"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q30154"
FT                   /db_xref="HGNC:HGNC:4953"
FT                   /db_xref="IMGT/HLA:DRB5*01:12"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1FV1"
FT                   /db_xref="PDB:1H15"
FT                   /db_xref="PDB:1HQR"
FT                   /db_xref="PDB:1ZGL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30154"
FT                   /protein_id="CAD20460.1"
FT                   /translation="RFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAV
FT                   TELGRPDAESWNSQKDFLERRRAEVDTVCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB5"
FT                   /allele="HLA-DRB5* variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 64 C; 101 G; 46 T; 0 other;
     cacgtttctt gcagcaggat aagtatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgca cagagacatc tataaccaag aggaggactt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgacgc cgagtcctgg aacagccaga       180
     aggacttcct ggagcggagg cgggccgagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer