spacer

EBI Dbfetch

ID   AJ426561; SV 1; linear; genomic DNA; STD; HUM; 3160 BP.
XX
AC   AJ426561;
XX
DT   02-JUL-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, A*23XX allele, exons 1-8
XX
KW   HLA-A gene; HLA-A*23XX allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3160
RA   Cox S.T.;
RT   ;
RL   Submitted (03-JAN-2002) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.;
RT   "Sequence of HLA-A*23XX";
RL   Unpublished.
XX
DR   MD5; 492cb6c691a25bfcb66e45e162815bf4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3160
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,204..473,715..990,1570..1845,1948..2064,
FT                   2507..2539,2682..2729,2898..2902)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="A*23XX allele"
FT                   /db_xref="GOA:Q8MGZ1"
FT                   /db_xref="IMGT/HLA:A*23:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MGZ1"
FT                   /protein_id="CAD20188.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFSTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRENLRI
FT                   ALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTVHIVGIIAGLVLLGAVITGAVVAAVMWRRNSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /number=1
FT                   /note="A*23XX allele"
FT   intron          74..203
FT                   /gene="HLA-A"
FT                   /number=1
FT                   /note="A*23XX allele"
FT   exon            204..473
FT                   /gene="HLA-A"
FT                   /number=2
FT                   /note="A*23XX allele"
FT   intron          474..714
FT                   /gene="HLA-A"
FT                   /number=2
FT                   /note="A*23XX allele"
FT   exon            715..990
FT                   /gene="HLA-A"
FT                   /number=3
FT                   /note="A*23XX allele"
FT   intron          991..1569
FT                   /gene="HLA-A"
FT                   /number=3
FT                   /note="A*23XX allele"
FT   exon            1570..1845
FT                   /gene="HLA-A"
FT                   /number=4
FT                   /note="A*23XX allele"
FT   intron          1846..1947
FT                   /gene="HLA-A"
FT                   /number=4
FT                   /note="A*23XX allele"
FT   exon            1948..2064
FT                   /gene="HLA-A"
FT                   /number=5
FT                   /note="A*23XX allele"
FT   intron          2065..2506
FT                   /gene="HLA-A"
FT                   /number=5
FT                   /note="A*23XX allele"
FT   exon            2507..2539
FT                   /gene="HLA-A"
FT                   /number=6
FT                   /note="A*23XX allele"
FT   intron          2540..2681
FT                   /gene="HLA-A"
FT                   /number=6
FT                   /note="A*23XX allele"
FT   exon            2682..2729
FT                   /gene="HLA-A"
FT                   /number=7
FT                   /note="A*23XX allele"
FT   intron          2730..2897
FT                   /gene="HLA-A"
FT                   /number=7
FT                   /note="A*23XX allele"
FT   exon            2898..>2902
FT                   /gene="HLA-A"
FT                   /number=8
FT                   /note="A*23XX allele"
XX
SQ   Sequence 3160 BP; 616 A; 905 C; 967 G; 672 T; 0 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg caggtgagtg cggggtcggg agggaaacgg cctctgcggg gagaagcaag       120
     gggcccgcct ggcgggggcg caagacccgg gaagccgcgc cgggaggagg gtcgggcggg       180
     tctcagccac tcctcgtccc caggctccca ctccatgagg tatttctcca catccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagggg ccggagtatt gggaccagga gacacggaat atgaaggccc actcacagac       420
     tgaccgagag aacctgcgga tcgcgctccg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tcattcccca cggacgggcc gggtcgccca       540
     cagtctccgg gtccgagatc caccccgaag ccgcgggacc ccgagaccct tgccccggga       600
     gaggcccagg cgccttaacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       660
     ggtcggggcc gggcggggct cgggggactg ggctgaccgc ggggtcgggg ccaggttctc       720
     acaccctcca gatgatgttt ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt       780
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt       840
     ggaccgcggc ggacatggcg gctcagatca cccagcgcaa gtgggaggcg gcccgtgtgg       900
     cggagcagtt gagagcctac ctggagggca cgtgcgtgga cgggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctacctgat      1020
     cgcctgtagg tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcgc cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1140
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1200
     ctgacggaat gacggaaaga cgatccctcg aatactgatg actggttccc tttgacaccg      1260
     gcagcagcct tgggaccgtg acttttcctc tcaggccttg ttctctgctt cacactcaat      1320
     gtgtgtgggg gtctgagtcc agcacttctg agtccctcag cctccactca ggtcaggacc      1380
     agaagtcgct gttccctcct cagggaatag aagattatcc caggtgcctg tgtccaggct      1440
     ggtgtctggg ttctgtgctc tcttccccat cccgggtgtc ctgtccattc tcaagatggc      1500
     cacatgcatg ctggtggagt gtcccatgac agatgcaaaa tgcctgaatt ttctgactct      1560
     tcccgtcaga cccccccaag acacatatga cccaccaccc catctctgac catgaggcca      1620
     ctctgagatg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1680
     atggggagga ccagacccag gacacggagc ttgtggagac caggcctgca ggggatggaa      1740
     ccttccagaa gtgggcagct gtggtggtac cttctggaga ggagcagaga tacacctgcc      1800
     atgtgcagca tgagggtctg cccaagcccc tcaccctgag atggggtaag gagggagatg      1860
     ggggtgtcat gtctcttagg gaaagcagga gcctctctgg agacctttag cagggtcagg      1920
     gcccctcacc ttcccctctt ttcccagagc catcttccca gcccaccgtc cacatcgtgg      1980
     gcatcattgc tggcctggtt ctccttggag ctgtgatcac tggagctgtg gtcgctgctg      2040
     tgatgtggag gaggaacagc tcaggtggag aaggggtgaa gggtggggtc tgagatttct      2100
     tgtctcactg agggttccaa gccccagcta gaaatgtgcc ctgtctcatt actgggaagc      2160
     accatccaca atcatgggcc gacccagcct gggccctgtg tgccagcact tactcttttg      2220
     taaagcacct gtgacaatga aggacagatt tatcaccttg attatggcgg tgatgggacc      2280
     tgatcccagc agtcacaagt cacaggggaa ggtccctgac gacagatctc aggagggcga      2340
     ttggtccagg gcccacatct gctttcttca tgtttcctga tcctgccctg ggtctgcagt      2400
     cacacatttc tggaaacttc tctggggtcc aagactagga ggttcctcta ggaccttaag      2460
     gccctggctc ctttctggta tctcacagga cattttcttc ccacagatag aaaaggaggg      2520
     agctactctc aggctgcaag taagtatgaa ggaggctgat gcctgaggtc cttgggatat      2580
     tgtgtttggg agcccatggg ggagctcaac caccccacaa ttcctcctct agccacatct      2640
     tctgtgggat ctgaccaggt tctgtttttg ttctacccca ggcagtgaca gtgcccaggg      2700
     ctctgatgtg tctctcacag cttgtaaagg tgagagcttg gagggcctga tgtgtgttgg      2760
     gtgttgggcg gaacagtgga cacagctgtg ctatggggtt tctttgcatt ggatgtattg      2820
     agcatgcgat gggctgttta aagtgtgacc cctcactgtg acagatatga agttgttcat      2880
     gaattttttt tctatagtgt gagacagctg ccttgtgtgg gactgaaagg caagagttgt      2940
     tcctgccctt ccctttgtga cttgaaaaac cctgactttg tttctgcaaa ggcacctgca      3000
     tgtgtctgtg ttcatgtagg cataatgtga ggaggtgggg agaccacccc acccccatgt      3060
     ccaccatgac cctcttccca cgctgacctg tgctccctcc ccaaaagctt gcggaagggc      3120
     gaattcgttt aaacctgcag gactagtccc tttagtgagg                            3160
//


spacer
spacer