Dbfetch

ID   AJ426470; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ426470;
XX
DT   04-JAN-2002 (Rel. 70, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for human leucocyte antigen, exon 2,
DE   isolate 23477, joined CDS
XX
KW   HLA-B gene; human leucocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   van den Berg-Loonen E.M.;
RT   ;
RL   Submitted (21-DEC-2001) to the INSDC.
RL   van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS.
XX
RN   [2]
RA   Swelsen W., Voorter C., van den Berg-Loonen E.;
RT   "Exons 1 through 5 of the HLA B5/35 cross reacting group";
RL   Unpublished.
XX
DR   MD5; 1a5d74756554d1ddb2ba9d2568fa1605.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /isolate="23477"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ426467.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="human leucocyte antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*52:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q8WLR6"
FT                   /protein_id="CAD20130.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRTE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
XX
SQ   Sequence 270 BP; 60 A; 88 C; 86 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtcagag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//