spacer

EBI Dbfetch

ID   AJ426462; SV 1; linear; genomic DNA; STD; HUM; 73 BP.
XX
AC   AJ426462;
XX
DT   04-JAN-2002 (Rel. 70, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for human leucocyte antigen, exon 1,
DE   isolate 22035, joined CDS
XX
KW   HLA-B gene; human leucocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-73
RA   van den Berg-Loonen E.M.;
RT   ;
RL   Submitted (21-DEC-2001) to the INSDC.
RL   van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS.
XX
RN   [2]
RA   Swelsen W., Voorter C., van den Berg-Loonen E.;
RT   "Exons 1 through 5 of the HLA B5/35 cross reacting group";
RL   Unpublished.
XX
DR   MD5; f120e03791c97244c1732fa74f0f375d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..73
FT                   /organism="Homo sapiens"
FT                   /isolate="22035"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,AJ426465.1:1..270,AJ426466.1:1..276,
FT                   AJ426463.1:1..276,AJ426464.1:1..>117)
FT                   /gene="HLA-B"
FT                   /product="human leucocyte antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8WLR8"
FT                   /db_xref="IMGT/HLA:B*51:01:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8WLR8"
FT                   /protein_id="CAD20128.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRI
FT                   ALRYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRHLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSS"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /number=1
XX
SQ   Sequence 73 BP; 8 A; 27 C; 27 G; 11 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccg                                                           73
//


spacer
spacer