spacer

EBI Dbfetch

ID   AJ420288; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ420288;
XX
DT   16-JUN-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, DRB1*03 allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*03 allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC Class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Soteriou B.A.;
RT   ;
RL   Submitted (16-NOV-2001) to the INSDC.
RL   Soteriou B.A., Immunogenetics, Anthony Nolan Research Institute, Royal Free
RL   Hospital,Pond Street, LONDON, NW3 2QG , UNITED KINGDOM.
XX
RN   [2]
RA   Soteriou B.A.;
RT   "Sequence of DRB1*03xx";
RL   Unpublished.
XX
DR   MD5; 67d89a86699cea18278d237640a4b7bf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA DRB1"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentating molecule"
FT                   /note="DRB1*03 allele"
FT                   /db_xref="GOA:Q8MGZ2"
FT                   /db_xref="IMGT/HLA:DRB1*03:22"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MGZ2"
FT                   /protein_id="CAD12395.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFDNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 59 A; 63 C; 99 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc gataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaacta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer