Dbfetch

ID   AJ420252; SV 1; linear; genomic DNA; STD; HUM; 3416 BP.
XX
AC   AJ420252;
XX
DT   18-NOV-2002 (Rel. 73, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, CW*1701 allele, exons 1-8
XX
KW   HLA-C gene; HLA-CW*1701 allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3416
RA   Cox S.T.;
RT   ;
RL   Submitted (16-NOV-2001) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Full genomic sequence alignments for HLA-B and -C";
RL   Unpublished.
XX
DR   MD5; f7ede09a9d4288b634741b853423d59c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3416
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="RSH"
FT                   /db_xref="taxon:9606"
FT   CDS             join(300..372,503..772,1019..1294,1882..2157,2282..2419,
FT                   2858..2890,2998..3045,3210..3214)
FT                   /gene="HLA-C"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="CW*1701 allele"
FT                   /db_xref="GOA:Q95604"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*17:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q95604"
FT                   /protein_id="CAD12437.1"
FT                   /translation="MRVMAPQALLLLLSGALALIETWAGSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEAGSHTIQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAAREAEQLRAYLEGECVEWLRGYLENGKETLQRAERPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLQEPCTLRWKPSSQPTIPNLGIVSGPAVLAVLAVLAVLAVLGAVVAAVIHR
FT                   RKSSGGKGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            300..372
FT                   /gene="HLA-C"
FT                   /number=1
FT                   /note="CW*1701 allele"
FT   intron          373..502
FT                   /gene="HLA-C"
FT                   /number=1
FT                   /note="CW*1701 allele"
FT   exon            503..772
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="CW*1701 allele"
FT   intron          773..1018
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="CW*1701 allele"
FT   exon            1019..1294
FT                   /gene="HLA-C"
FT                   /number=3
FT                   /note="CW*1701 allele"
FT   intron          1295..1881
FT                   /gene="HLA-C"
FT                   /number=3
FT                   /note="CW*1701 allele"
FT   exon            1882..2157
FT                   /gene="HLA-C"
FT                   /number=4
FT                   /note="CW*1701 allele"
FT   intron          2158..2281
FT                   /gene="HLA-C"
FT                   /number=4
FT                   /note="CW*1701 allele"
FT   exon            2282..2419
FT                   /gene="HLA-C"
FT                   /number=5
FT                   /note="CW*1701 allele"
FT   intron          2420..2857
FT                   /gene="HLA-C"
FT                   /number=5
FT                   /note="CW*1701 allele"
FT   exon            2858..2890
FT                   /gene="HLA-C"
FT                   /number=6
FT                   /note="CW*1701 allele"
FT   intron          2891..2997
FT                   /gene="HLA-C"
FT                   /number=6
FT                   /note="CW*1701 allele"
FT   exon            2998..3045
FT                   /gene="HLA-C"
FT                   /number=7
FT                   /note="CW*1701 allele"
FT   intron          3046..3209
FT                   /gene="HLA-C"
FT                   /number=7
FT                   /note="CW*1701 allele"
FT   exon            3210..3214
FT                   /gene="HLA-C"
FT                   /number=8
FT                   /note="CW*1701 allele"
XX
SQ   Sequence 3416 BP; 633 A; 1006 C; 1060 G; 717 T; 0 other;
     tggtgtagaa gaagagggat caggacgaag tcccaggtcc cgggcggggc tctctgggtc        60
     tcaagctccc agggccgtgt ctgcattggg gaggcgcagc gttggggatt ccccactccc       120
     actcccctga gtttcacttc ttctcccaac ctgcgtcggg tccttcttcc tgaatactca       180
     tgacgcgtcc ccaattccca ctcccattgg gtgtcgggtt ctagagaagc caatcagcgt       240
     ctacgcagtc ccggttctga agtcacccac ccggactcag attctcccca gacgccgaga       300
     tgcgggtcat ggcgccccaa gccctcctcc tgctgctctc gggagccctg gccctgatcg       360
     agacctgggc cggtgagtgc ggggttggga gggaaacggc ctctgcggag aggagcgagg       420
     ggcccgcccg gcgagggcgc aggacccggg gagccgcgca gggaggaggg tcgggcgggt       480
     ctcagcccct cctcgccccc aggctcccac tccatgaggt atttctacac cgccgtgtcc       540
     cggcccggcc gcggagagcc ccgcttcatc gcagtgggct acgtggacga cacgcagttc       600
     gtgcggttcg acagcgacgc cgcgagtccg agaggggagc cgcgggcgcc gtgggtggag       660
     caggaggggc cggagtattg ggaccgggag acacagaagt acaagcgcca ggcacaggct       720
     gaccgagtga acctgcggaa actgcgcggc tactacaacc agagcgaggc cggtgagtga       780
     ccccagcccg gggcgcaggt cacgacccct ccccatcccc cacggacggc ccgggtcgcc       840
     ccgagtctcc cggtctgaga tcctccccga ggctgcggaa cccgcccaga ccctcgaccg       900
     gagagagccc tagtcgcctt tacccggttt cattttcagt ttaggccaaa atccccgcgg       960
     gttggtcggg gctggggcgg ggctcggggg acggggctga ccacgggggc ggggccaggt      1020
     tctcacacca tccagaggat gtatggctgc gacctggggc ccgacgggcg cctcctccgc      1080
     gggtataacc agttcgccta cgacggcaag gattacatcg ccctgaacga ggacctgcgc      1140
     tcctggaccg cggcggacac ggcggctcag atctcccagc gcaagttgga ggcggcccgt      1200
     gaggcggagc agctgagagc ctacctggag ggcgagtgcg tggagtggct ccgcggatac      1260
     ctggagaacg ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc      1320
     ccatctccta tagatctccc gggatggcct cccacgagga ggggaggaaa atgggatcag      1380
     cgctagaata tcgccctccc ttgaatggag aatgggatga gttttcccga gtttcctctg      1440
     agggccccgt ctgctctcta ggacaattaa gggatgaagt ccctgaggaa atggagggga      1500
     agacagtccc tggaatactg atcaggggtc ccctttgacc actttgacca ctgcggcagc      1560
     tgtggtcagg ctgctgacct ttctctcagg ccttgttctc tgcctcacac tcaatgtgtc      1620
     tgaaggtttg attccagctt ttctgagtcc ttcggcctcc actcaggtca ggaccagaag      1680
     tcgctgttcc tccctcagag actagaactt tccaaagaat aggagattat cccaggtccc      1740
     tgtgtccagg ctggcgtctg ggttctgtgc cccctttcct accccaggtg tcctgtccat      1800
     tctcaggatg gtcacatggg cgctgctgga gtgtcgcaag agagatacaa agtgtctgaa      1860
     ttttctgact cttcccgtca gaacgcccaa agacacacgt gacccaccat cccgtctctg      1920
     accatgaggc caccctgagg tgctgggccc tgggcttcta ccctgcggag atcacactga      1980
     cctggcagcg ggatggggag gaccaaactc aggacaccga gcttgtggag accaggccag      2040
     caggagatgg aaccttccag aagtgggcag ctgtggtggt gccttctgga caagaacaga      2100
     gatacacgtg ccatgtgcag cacgaggggc tgcaggagcc ctgcaccctg agatggagta      2160
     aggaggggga tgaggggtca tgtgtcttct cagggaaagc agaagtcctt ctggagccct      2220
     tcagccgggt cagggctgag gcttgggtgt aagggcccct caccttcccc tcctttccca      2280
     gagccgtctt cccagcccac catccccaac ttgggcatcg tttctggccc agctgtcctg      2340
     gctgtcctgg ctgtcctggc tgtcctagct gtcctaggag ctgtggtcgc tgctgtgata      2400
     cataggagga agagctcagg tagggaaggg gtgaggagtg gggtctgggt tttcttgtcc      2460
     cactgggagt ttcaagcccc aggtagaagt gtgccccacc tcgttactgg aagcaccatc      2520
     cacacctggg ccatcccagc ctgggaccct gtgtgccagc acttactctg ttgtgaagca      2580
     catgacaacg aaggacagat gtatcacctt gatgattatg gtgttggggt cctgattcca      2640
     gcattcgtga gtcaggggaa ggtccctgct aaggacagac cttaggaggg cagttgctcc      2700
     agaacccaca gctgctttcc ccgtgtttcc tgatcctgcc ctgggtctgc agtcatagtt      2760
     ctggaaactt ctcttgggtc caagactagg aggttcccct aagatcgcat ggccctgcct      2820
     cctccctgtc ccctcacagg gcattttctt cccacaggtg gaaaaggagg gagctgctct      2880
     caggctgcgt gtaagtgatg ccggtgggcg tgtggaggag ctcacctacc ccataattcc      2940
     tcttgtccca catctcctgc gggctctgac caggtctttt tttttgttct accccagcca      3000
     gcaacagtgc ccagggctct gatgagtctc tcatcgcttg taaaggtgag attctgggga      3060
     gctgaagtgg tcgggggtgg ggcagaggga aaaggcctgg gtaatgggga tcctttgatt      3120
     gggacgtttc gagtgtgtgg tggactgttc agagtgtcat cacttaccat gactgacctg      3180
     aatttgttca tgactattgt gttctgtagc ctgagacagc tgcctgtgtg ggactgagat      3240
     gcaggatttc ttcacacctc tcctttgtga cttcaagagc ctctggcatc tctttctgca      3300
     aaggcatctg aatgtgtctg cgttcctgtt agcataatat gaggagttgg agagacagct      3360
     cacccccgtg tccaccgtga cccctgtccc cacactgacc tgtgttccct ccccga          3416
//