spacer

EBI Dbfetch

ID   AJ420250; SV 2; linear; genomic DNA; STD; HUM; 3397 BP.
XX
AC   AJ420250;
XX
DT   18-NOV-2002 (Rel. 73, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, CW*15021 allele, exons 1-8
XX
KW   HLA-C gene; HLA-CW*15021 allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Cox S.T.;
RT   ;
RL   Submitted (16-NOV-2001) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Full genomic sequence alignments for HLA-B and -C";
RL   Unpublished.
XX
RN   [3]
RP   1-3397
RA   Cox S.T.;
RT   ;
RL   Submitted (30-SEP-2005) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
DR   MD5; 2ebe9779457b28027f9cd52f29247bd9.
DR   Ensembl-Gn; ENSG00000206435; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206452; homo_sapiens.
DR   Ensembl-Tr; ENST00000400341; homo_sapiens.
DR   Ensembl-Tr; ENST00000400394; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3397
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="BOB"
FT                   /db_xref="taxon:9606"
FT   CDS             join(301..373,504..773,1020..1295,1883..2158,2280..2399,
FT                   2839..2871,2979..3026,3191..3195)
FT                   /gene="HLA-C"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="CW*15021 allele"
FT                   /db_xref="GOA:Q07000"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*15:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07000"
FT                   /protein_id="CAD12435.1"
FT                   /translation="MRVMAPRTLLLLLSGALALTETWACSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQTDRVNLRK
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQLAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            301..373
FT                   /gene="HLA-C"
FT                   /number=1
FT                   /note="CW*15021 allele"
FT   intron          374..503
FT                   /gene="HLA-C"
FT                   /number=1
FT                   /note="CW*15021 allele"
FT   exon            504..773
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="CW*15021 allele"
FT   intron          774..1019
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="CW*15021 allele"
FT   exon            1020..1295
FT                   /gene="HLA-C"
FT                   /number=3
FT                   /note="CW*15021 allele"
FT   intron          1296..1882
FT                   /gene="HLA-C"
FT                   /number=3
FT                   /note="CW*15021 allele"
FT   exon            1883..2158
FT                   /gene="HLA-C"
FT                   /number=4
FT                   /note="CW*15021 allele"
FT   intron          2159..2279
FT                   /gene="HLA-C"
FT                   /number=4
FT                   /note="CW*15021 allele"
FT   exon            2280..2399
FT                   /gene="HLA-C"
FT                   /number=5
FT                   /note="CW*15021 allele"
FT   intron          2400..2838
FT                   /gene="HLA-C"
FT                   /number=5
FT                   /note="CW*15021 allele"
FT   exon            2839..2871
FT                   /gene="HLA-C"
FT                   /number=6
FT                   /note="CW*15021 allele"
FT   intron          2872..2978
FT                   /gene="HLA-C"
FT                   /number=6
FT                   /note="CW*15021 allele"
FT   exon            2979..3026
FT                   /gene="HLA-C"
FT                   /number=7
FT                   /note="CW*15021 allele"
FT   intron          3027..3190
FT                   /gene="HLA-C"
FT                   /number=7
FT                   /note="CW*15021 allele"
FT   exon            3191..3195
FT                   /gene="HLA-C"
FT                   /number=8
FT                   /note="CW*15021 allele"
XX
SQ   Sequence 3397 BP; 635 A; 995 C; 1057 G; 710 T; 0 other;
     tggtgtagga gaagagggat caggacgaag tcccaggtcc cgggcggggc tctcagggtc        60
     tcaggctcca agggccgtgt ctgcactggg gaggcgccgc gttgaggatt ctccactccc       120
     ctgagtttca cttcttctcc caacctgcga cgggtccttc ttcctgaata ctcatgacgc       180
     gtccccaatt cccactccca ttgggtgtcg ggttctagag aagccaatca gcgtctccgc       240
     agtcccggtt ctaaagtccc cagtcaccca cccggactcg gattctcccc agacgccgag       300
     atgcgggtca tggcgccccg aaccctcctc ctgctgctct cgggagccct ggccctgacc       360
     gagacctggg cctgtgagtg cggggttggg agggaaacgg cctctgcgga gaggagcgag       420
     gggcccgccc ggcgagggcg caggacccgg ggagccgcgc agggaggagg gtcgggcggg       480
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttctaca ccgctgtgtc       540
     ccggcccggc cgcggagagc cccacttcat cgcagtgggc tacgtggacg acacgcagtt       600
     cgtgcggttc gacagcgacg ccgcgagtcc aagaggggag ccgcgggcgc cgtgggtgga       660
     gcaggagggg ccggagtatt gggaccggga gacacagaac tacaagcgcc aggcacagac       720
     tgaccgagtg aacctgcgga aactgcgcgg ctactacaac cagagcgagg ccggtgagtg       780
     accccggccc ggggcgcagg tcacgacccc tccccatccc ccacggacgg cccgggtcgc       840
     cccgagtctc ccggtctgag atccaccccg aggctgcgga acccgcccag accctcgacc       900
     ggagagagcc ccagtcacct ttacccggtt tcattttcag tttaggccaa aatccccgcg       960
     ggttggtcgg ggctggggcg gggctcgggg gacggggctg accacggggg cggggccagg      1020
     gtctcacatc atccagagga tgtatggctg cgacctgggg cccgacgggc gcctcctccg      1080
     cgggcatgac cagttagcct acgacggcaa ggattacatc gccctgaacg aggacctgcg      1140
     ctcctggacc gccgcggaca cggcggctca gatcacccag cgcaagtggg aggcggcccg      1200
     tgaggcggag cagctgagag cctacctgga gggcacgtgc gtggagtggc tccgcagata      1260
     cctggagaac gggaaggaga cgctgcagcg cgcgggtacc aggggcagtg gggagccttc      1320
     cctatctcct gtagatctcc cgggatggcc ttccacgagg aggggaggaa aatgggatca      1380
     gcgctagaat atcgccctcc cttgaatgga gaatgggatg agttttcctg agtttcctct      1440
     gagggccccc tctgctctct aggacaatta agggatgaag tccttgagga aatggagggg      1500
     aagacagtcc ctggaatact gatcaggggt cccctttgac cactttgacc actgcagcag      1560
     ctgtggtcag gctgctgacc tttctctcag gccttgttct ctgcctcacg ctcaatgtgt      1620
     ttgaaggttt gattccagct tttctgagtc cttcggcctc cactcaggtc aggaccagaa      1680
     gtcgctgttc ctccctcaga gactagaact ttccaatgaa taggagatta tcccaggtgc      1740
     ctgtgtccag gctggcgtct gggttctgtg cccccttccc caccccaggt gtcctgtcca      1800
     ttctcaggat ggtcacatgg gcgctgttgg agtgtcgcaa gagagataca aagtgtctga      1860
     attttctgac tcttcccgtc agaacaccca aagacacacg tgacccacca tcccgtctct      1920
     gaccatgagg ccaccctgag gtgctgggcc ctgggcttct accctgcgga gatcacactg      1980
     acctggcagc gggatggcga ggaccaaact caggacaccg agcttgtgga gaccaggcca      2040
     gcaggagatg gaaccttcca gaagtgggca gctgtggtgg tgccttctgg agaagagcag      2100
     agatacacgt gccatgtgca gcacgagggg ctgccggagc ccctcaccct gagatggggt      2160
     aaggaggggg atgaggggtc atgtgtcttc tcagggaaag cagaagtcct ggagcccttc      2220
     agctgggtca gggctgaggc ttgggggtca gggcccctca ccttcccctc ctttcccaga      2280
     gccatcttcc cagcccacca tccccatcgt gggcatcgtt gctggcctgg ctgtcctggc      2340
     tgtcctagct gtcctaggag ctgtgatggc tgttgtgatg tgtaggagga agagctcagg      2400
     tagggaaggg gtgaggagtg gggtctgggt tttcttgtcc cactgggagt ttcaagcccc      2460
     aggtagaagt gtgccccacc tcgttactgg aagcaccatc cacacatggg ccatcccagc      2520
     ctgggaccct gtgtgccagc acttactctg ttgtgaagca catgacaatg aaggacagat      2580
     gtatcacctt gatgattatg gtgttggggt ccttgattcc agcattcatg agtcagggga      2640
     aggtccctgc taaggacaga ccttaggagg gcagttgctc cagaacccac agctgctttc      2700
     cccgtgtttc ctgatcctgc cctgggtctg cagtcatagt tctggaaact tctcttgggt      2760
     ccaagactag gaggttcccc taagatcgca tggccctgcc tcctccctgt cccctcacag      2820
     ggcattttct tcccacaggt ggaaaaggag ggagctgctc tcaggctgcg tgtaagtgat      2880
     ggcggtgggc gtgtggagga gcttacccac cccataattc ctcttgtccc acatctcctg      2940
     cgggctctga ccaggtcttt ttttttgttc taccccagcc agcaacagtg cccagggctc      3000
     tgatgagtct ctcatcgctt gtaaaggtga gattctgggg agctgaagtg gtcgggggtg      3060
     gggcagaggg aaaaggccta ggtaatgggg atcctttgat tgggacgttt cgaatgtgtg      3120
     gtgagctgtt cagagtgtca tcacttacca tgactgacct gaatttgttc atgactattg      3180
     tgttctgtag cctgagacag ctgcctgtgt gggactgaga tgcaggattt cttcacacct      3240
     ctcctttgtg acttcaagag cctctggcat ctctttctgc aaaggcatct gaatgtgtct      3300
     gcgttcctgt tagcataatg tgaggaggtg gagagacagc ccacccccgt gtccaccgtg      3360
     acccctgtcc ccacactgac ctgtgttccc tccccga                               3397
//


spacer
spacer