Dbfetch

ID   AJ420240; SV 1; linear; genomic DNA; STD; HUM; 2862 BP.
XX
AC   AJ420240;
XX
DT   18-NOV-2002 (Rel. 73, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, B*52011 allele, exons 1-7
XX
KW   HLA-B gene; HLA-B*52011 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2862
RA   Cox S.T.;
RT   ;
RL   Submitted (16-NOV-2001) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Full genomic sequence alignments for HLA-B and -C";
RL   Unpublished.
XX
DR   MD5; ec15902711ac269ef0af978459d0cc0c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2862
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="E4181"
FT                   /db_xref="taxon:9606"
FT   CDS             join(302..374,504..773,1019..1294,1870..2145,2250..2366,
FT                   2808..>2840)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="B*5201 allele"
FT                   /db_xref="GOA:Q8HWR0"
FT                   /db_xref="IMGT/HLA:B*52:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWR0"
FT                   /protein_id="CAD12425.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRI
FT                   ALRYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRHLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAA"
FT   exon            302..374
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*5201 allele"
FT   intron          375..503
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*5201 allele"
FT   exon            504..773
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*5201 allele"
FT   intron          774..1018
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*5201 allele"
FT   exon            1019..1294
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*5201 allele"
FT   intron          1295..1869
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*5201 allele"
FT   exon            1870..2145
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*5201 allele"
FT   intron          2146..2249
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*5201 allele"
FT   exon            2250..2366
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*5201 allele"
FT   intron          2367..2807
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*5201 allele"
FT   exon            2808..2840
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*5201 allele"
XX
SQ   Sequence 2862 BP; 538 A; 850 C; 910 G; 564 T; 0 other;
     tggtgtagga gaagagggat caggacgaag tcccaggccc cgggcggggc tctcagggtc        60
     tcaggctccg agagccttgt ctgcattggg gaggcgcagc gttggggatt ccccactccc       120
     acgagtttca cttcttctcc caacctatgt cgggtccttc ttccaggata ctcgtgacgc       180
     gtccccattt cccactccca ttgggtgtcg gatatctaga gaagccaatc agtgtcgccg       240
     gggtcccagt tctaaagtcc ccacgcaccc acccggactc agaatctcct cagacgccga       300
     gatgcgggtc acggcgcccc gaaccgtcct cctgctgctc tggggggcag tggccctgac       360
     cgagacctgg gccggtgagt gcggggtcgg gagggaaatg gcctctgtgg ggaggagcga       420
     ggggaccgca ggcgggggcg caggacctga ggagccgcgc cgggaggagg gtcgggcggg       480
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttctaca ccgccatgtc       540
     ccggcccggc cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacccagtt       600
     cgtgaggttc gacagcgacg ccgcgagtcc gaggacggag ccccgggcgc catggataga       660
     gcaggagggg ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac       720
     ttaccgagag aacctgcgga tcgcgctccg ctactacaac cagagcgagg ccggtgagtg       780
     accccggccc ggggcgcagg tcacgactcc ccatccccca cgtacggccc gggtcgcccc       840
     gagtctccgg gtccgagatc cgcctccctg aggccgcggg acccgcccag accctcgacc       900
     ggcgagagcc ccaggcgcgt ttacccggtt tcattttcag ttgaggccaa aatccccgcg       960
     ggttggtcgg ggcggggcgg ggctcggggg acggtgctga ccgcggggcc ggggccaggg      1020
     tctcacactt ggcagacgat gtatggctgc gacgtggggc cggacgggcg cctcctccgc      1080
     gggcataacc agtacgccta cgacggcaaa gattacatcg ccctgaacga ggacctgagc      1140
     tcctggaccg cggcggacac cgcggctcag atcacccagc gcaagtggga ggcggcccgt      1200
     gaggcggagc agctgagagc ctacctggag ggcctgtgcg tggagtggct ccgcagacac      1260
     ctggagaacg ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc      1320
     ccatctccta taggtcgccg gggatggcct cccacgagaa gaggaggaaa atgggatcag      1380
     cgctagaatg tcgccctccc ttgaatggag aatggcatga gttttcctga gtttcctctg      1440
     agggccccct cttctctcta ggacaattaa gggatgacgt ctctgaggaa atggagggga      1500
     agacagtccc tagaatactg atcaggggtc ccctttgacc cctgcagcag ccttgggaac      1560
     cgtgactttt cctctcaggc cttgttctct gcctcacact cagtgtgttt ggggctctga      1620
     ttccagcact tctgagtcac tttacctcca ctcagatcag gagcagaagt ccctgttccc      1680
     cgctcagaga ctcgaacttt ccaatgaata ggagattatc ccaggtgcct gcgtccaggc      1740
     tggtgtctgg gttctgtgcc ccttccccac accaggtgtc ctgtccattc tcaggctggt      1800
     cacatgggtg gtcctagggt gtcccatgag agatgcaaag cgcctgaatt ttctgactct      1860
     tcccatcaga ccccccaaag acacacgtga cccaccaccc cgtctctgac catgaggcca      1920
     ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1980
     atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca ggagatagaa      2040
     ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga tacacatgcc      2100
     atgtacagca tgaggggctg ccgaagcccc tcaccctgag atggggtaag gagggggatg      2160
     aggggtcata tctcttctca gggaaagcag gagcccttct ggagcccttc agcagggtca      2220
     gggcccctcg tcttcccctc ctttcccaga gccatcttcc cagtccacca tccccatcgt      2280
     gggcattgtt gctggcctgg ctgtcctagc agttgtggtc atcggagctg tggtcgctac      2340
     tgtgatgtgt aggaggaaga gctcaggtag ggaaggggtg aggggtgggg tctgggtttt      2400
     cttgtcccac tgggggtttc aagccccagg tagaagtgtt ccctgcctca ttactgggaa      2460
     gcagcatcca cacaggggct aacgcagcct gggaccctgt gtgccagcac ttactctttt      2520
     gtgcagcaca tgtgacaatg aaggacggat gtatcacctt gatggttgtg gtgttggggt      2580
     cctgatttca gcattcatga gtcaggggaa ggtccctgct aaggacagac cttaggaggg      2640
     cagttggtcc aggacccaca cttgctttcc tcgtgtttcc tgatcctgcc ttgggtctgt      2700
     agtcatactt ctggaaattc cttttgggtc caagacgagg aggttcctct aagatctcat      2760
     ggccctgctt cctcccagtc ccctcacagg acattttctt cccacaggtg gaaaaggagg      2820
     gagctactct caggctgcgt gtaagtggtg ggggtgggag tg                         2862
//