spacer

EBI Dbfetch

ID   AJ418708; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ418708;
XX
DT   02-NOV-2002 (Rel. 73, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-Cw gene for MHC class I antigen, exon 2,
DE   HLA-Cw*0102new allele and joined CDS
XX
KW   HLA-Cw gene; HLA-Cw*0102new allele; human leucocyte antigen Cw;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Wu S.;
RT   ;
RL   Submitted (02-NOV-2001) to the INSDC.
RL   Wu S., Medical Technology, Tzu Chi University, #701, Chung Yang Rd.,
RL   Section III, Hualien, Taiwan, 970, TAIWAN.
XX
RN   [2]
RA   Wu S.;
RT   "Point mutation in the alpha helix of HLA-C alpha-2 domain generates a
RT   novel HLA-C allele (HLA-Cw*0102new) in a Han Chinese individual in Taiwan";
RL   Unpublished.
XX
DR   MD5; 49f153cdbec8419aa2433e58f1d37b48.
XX
CC   Related sequence: AJ418709
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /isolate="Han Chinese"
FT                   /mol_type="genomic DNA"
FT                   /country="Taiwan"
FT                   /cell_type="peripheral blood cells"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ418709.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /note="Cw*0102new allele"
FT                   /db_xref="GOA:Q8HWR1"
FT                   /db_xref="IMGT/HLA:C*01:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWR1"
FT                   /protein_id="CAD12801.1"
FT                   /translation="SHSMKYFFTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMCGCDLGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /number=2
FT                   /note="Cw*0102new allele"
XX
SQ   Sequence 270 BP; 54 A; 82 C; 96 G; 38 T; 0 other;
     gctcccactc catgaagtat ttcttcacat ccgtgtcccg gcctggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer