spacer

EBI Dbfetch

ID   AJ417669; SV 1; linear; genomic DNA; STD; HUM; 117 BP.
XX
AC   AJ417669;
XX
DT   01-DEC-2001 (Rel. 69, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, exon 5, isolate
DE   21871
XX
KW   HLA-B gene; human leucocyte antigen B; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-117
RA   van den Berg-Loonen E.M.;
RT   ;
RL   Submitted (15-OCT-2001) to the INSDC.
RL   van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS.
XX
RN   [2]
RA   Swelsen W.T., Voorter C.E., van den Berg-Loonen E.M.;
RT   "Sequence-based typing of the B35 Cross reacting group,including exons 1, 4
RT   and 5";
RL   Unpublished.
XX
DR   MD5; c22f7163f834f939765d7d9e3de856a9.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232126; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
DR   Ensembl-Tr; ENST00000418147; homo_sapiens.
DR   Ensembl-Tr; ENST00000425798; homo_sapiens.
DR   Ensembl-Tr; ENST00000450871; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..117
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="21871"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>117
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*35:42:01"
FT                   /db_xref="UniProtKB/TrEMBL:Q861E2"
FT                   /protein_id="CAD10401.1"
FT                   /translation="PSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSS"
FT   exon            1..117
FT                   /gene="HLA-B"
FT                   /number=5
XX
SQ   Sequence 117 BP; 19 A; 31 C; 36 G; 31 T; 0 other;
     agccatcttc ccagtccacc atccccatcg tgggcattgt tgctggcctg gctgtcctag        60
     cagttgtggt catcggagct gtggtcgcta ctgtgatgtg taggaggaag agctcag          117
//


spacer
spacer