Dbfetch

ID   AJ409215; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ409215;
XX
DT   17-MAR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*1310
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*1310 allele; human leucocyte antigen DR;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Guttridge M.G.;
RT   ;
RL   Submitted (13-MAR-2001) to the INSDC.
RL   Guttridge M.G., Tissue Typing, Welsh Blood Service, Ely Valley Road, Talbot
RL   Green, Pontyclun, Cardiff, CF72 9WB, UNITED KINGDOM.
XX
RN   [2]
RA   Hammond L., Guttridge M.G., Street J., Darke C.;
RT   "Confirmatory sequence and serology of DRB1*1310";
RL   Unpublished.
XX
DR   MD5; f6e1d4e7bf3b4bb38b1fc9a449ade9c2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="13976036"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="HLA-DRB1*1310 allele"
FT                   /db_xref="GOA:Q9BCM3"
FT                   /db_xref="IMGT/HLA:DRB1*13:10"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BCM3"
FT                   /protein_id="CAC34577.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEDKRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT                   /note="HLA-DRB1*1310 allele"
XX
SQ   Sequence 270 BP; 59 A; 65 C; 96 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacaag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//