spacer

EBI Dbfetch

ID   AJ409214; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   AJ409214;
XX
DT   17-MAR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen HLA-B*57KN allele,
DE   exons 2-3
XX
KW   HLA-B gene; HLA-B57KN allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RA   Guttridge M.G.;
RT   ;
RL   Submitted (13-MAR-2001) to the INSDC.
RL   Guttridge M.G., Tissue Typing, Welsh Blood Service, Ely Valley Road, Talbot
RL   Green, Pontyclun, Cardiff, CF72 9WB, UNITED KINGDOM.
XX
RN   [2]
RA   Guttridge M.G., Street J., Darke C.;
RT   "Identification, sequence and serology of HLA-B*57KN";
RL   Unpublished.
XX
DR   MD5; 37a638f42533e099a89b6c3f82871eaa.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="35980"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="HLA-B*57KN allele"
FT                   /db_xref="GOA:Q9BCM4"
FT                   /db_xref="IMGT/HLA:B*57:08"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BCM4"
FT                   /protein_id="CAC34576.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALPYYNQSEAGSHIIQVMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="HLA-B*57KN allele"
FT   intron          271..516
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="HLA-B*57KN allele"
FT   exon            517..792
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="HLA-B*57KN allele"
XX
SQ   Sequence 792 BP; 137 A; 263 C; 286 G; 106 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     acggggagac acggaacatg aaggcctccg cgcagactta ccgagagaac ctgcggatcg       240
     cgctccccta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccac       360
     ccccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcagggc ggggcggggc       480
     tcggggggac ggggctgacc gcggggccgg ggccagggtc tcacatcatc caggtgatgt       540
     atggctgcga cgtggggccg gacgggcgcc tcctccgcgg gcatgaccag tccgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgagctc ctggaccgcg gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag ctgagagcct       720
     acctggaggg cctgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc gg                                                           792
//


spacer
spacer