Dbfetch

ID   AJ404618; SV 2; linear; genomic DNA; STD; HUM; 261 BP.
XX
AC   AJ404618;
XX
DT   01-SEP-2000 (Rel. 64, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class 1 antigen, DRB1*11 allele,
DE   exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*11 allele; human leucocyte antigen;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Revised by [3]
RA   Poli F.;
RT   ;
RL   Submitted (19-JUN-2000) to the INSDC.
RL   Poli F., Centro Trasfusionale e di Immunologia Dei Trapianti, Ospedale
RL   Maggiore Di Milano, VIA F. SFORZA, 35, 20122 MILANO, ITALY.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.2001.057004388.x.
RX   PUBMED; 11380955.
RA   Longhi E., Frison S., Poli F., Scalamogna M., Sirchia G.;
RT   "Description of a new HLA-DRB1 allele, DRB1*1139";
RL   Tissue Antigens 57(4):388-389(2001).
XX
RN   [3]
RP   1-261
RA   Poli F.;
RT   ;
RL   Submitted (26-OCT-2000) to the INSDC.
RL   Poli F., Centro Trasfusionale e di Immunologia Dei Trapianti, Ospedale
RL   Maggiore Di Milano, VIA F. SFORZA, 35, 20122 MILANO, ITALY.
XX
DR   MD5; 5fe0abcf9bda8b065f136751a6b49fc8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..261
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>261
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen DRB1"
FT                   /function="antigen presenting molecule"
FT                   /note="DRB1*11 allele"
FT                   /db_xref="GOA:Q9GIX0"
FT                   /db_xref="IMGT/HLA:DRB1*11:39"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GIX0"
FT                   /protein_id="CAC06089.2"
FT                   /translation="PRFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRA
FT                   VRELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTV"
FT   exon            1..261
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT                   /note="DRB1*11 allele"
XX
SQ   Sequence 261 BP; 56 A; 59 C; 93 G; 53 T; 0 other;
     ccacgtttct tggagtactc tacgtctgag tgtcatttct tcaatgggac ggagcgggtg        60
     cggttcctgg acagatactt ctataaccaa gaggagtacg tgcgcttcga cagcgacgtg       120
     ggggagttcc gggcggtgag ggagctgggg cggcctgatg aggagtactg gaacagccag       180
     aaggacttcc tggaagacag gcgggccgcg gtggacacct actgcagaca caactacggg       240
     gttggtgaga gcttcacagt g                                                 261
//