Dbfetch

ID   AJ318865; SV 1; linear; genomic DNA; STD; HUM; 3396 BP.
XX
AC   AJ318865;
XX
DT   10-OCT-2001 (Rel. 69, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-Cw gene for MHC class I antigen, allele Cw*0302 variant
XX
KW   HLA-Cw gene; HLA-Cw*0302 allele variant; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3396
RA   Cox S.T.;
RT   ;
RL   Submitted (10-AUG-2001) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Sequence of Cw*03XX";
RL   Unpublished.
XX
DR   MD5; 3c738147c1e6dfb51872a27a5cedccc6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3396
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DAUDI"
FT                   /db_xref="taxon:9606"
FT   CDS             join(301..373,504..773,1019..1294,1882..2157,2279..2398,
FT                   2838..2870,2978..3025,3190..3194)
FT                   /gene="HLA-Cw"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="Cw*0302 allele variant"
FT                   /note="1 bp substitution in exon 5"
FT                   /db_xref="GOA:Q7YQB3"
FT                   /db_xref="IMGT/HLA:C*03:02:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YQB3"
FT                   /protein_id="CAC79613.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHILQRMYGCDVGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            301..373
FT                   /gene="HLA-Cw"
FT                   /number=1
FT   intron          374..503
FT                   /gene="HLA-Cw"
FT                   /number=1
FT   exon            504..773
FT                   /gene="HLA-Cw"
FT                   /number=2
FT   intron          774..1018
FT                   /gene="HLA-Cw"
FT                   /number=2
FT   exon            1019..1294
FT                   /gene="HLA-Cw"
FT                   /number=3
FT   intron          1295..1881
FT                   /gene="HLA-Cw"
FT                   /number=3
FT   exon            1882..2157
FT                   /gene="HLA-Cw"
FT                   /number=4
FT   intron          2158..2278
FT                   /gene="HLA-Cw"
FT                   /number=4
FT   exon            2279..2398
FT                   /gene="HLA-Cw"
FT                   /number=5
FT   intron          2399..2837
FT                   /gene="HLA-Cw"
FT                   /number=5
FT   exon            2838..2870
FT                   /gene="HLA-Cw"
FT                   /number=6
FT   intron          2871..2977
FT                   /gene="HLA-Cw"
FT                   /number=6
FT   exon            2978..3025
FT                   /gene="HLA-Cw"
FT                   /number=7
FT   intron          3026..3189
FT                   /gene="HLA-Cw"
FT                   /number=7
FT   exon            3190..3194
FT                   /gene="HLA-Cw"
FT                   /number=8
XX
SQ   Sequence 3396 BP; 630 A; 990 C; 1063 G; 713 T; 0 other;
     tggtgtagga gaagaggaat caggacgaag tcccaggtcc cgggcggggc tctcagggtc        60
     tcaggctcca agggccgtgt ctgcactggg gaggcgccgc gttgaggatt ctccactccc       120
     ctgagtttca cttcttctcc caacctgcgt cgggtccttc ttcctgaata ctcatgacgc       180
     gtccccaatt cccactccca ttgggtgtcg gattctagag aagccaatca gcgtctccgc       240
     agtcccggtt ctgaagtccc cagtcaccca cccggactca gattctcccc agacgccgag       300
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc       360
     gagacctggg ccggtgagtg cggggttggg agggaatcgg cctctgcgga gaggagcgag       420
     gggcccgccc ggcgagggcg caggacccgg ggagccgcgc agggaggagg gtcgggcggg       480
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttctaca ccgctgtgtc       540
     ccggcccggc cgcggggagc cccacttcat cgcagtgggc tacgtggacg acacgcagtt       600
     cgtgcggttc gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga       660
     gcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac       720
     tgaccgagtg agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccggtgagtg       780
     accccggccc ggggcgcagg tcacgacccc tcctcatccc ccacggacgg cccgggtcgc       840
     cccaagtctc ccggtctgag atccaccccg aggctgcgga acccgcccag accctcgacc       900
     ggagagagcc ccagtcacct ttacccggtt tcattttcag tttaggccaa aatccccgcg       960
     ggttggtcgg ggcggggcgg ggctcggggg acggggctga ccgcgggggc ggggccaggg      1020
     tctcacatcc tccagaggat gtatggctgc gacgtggggc ccgacgggcg cctcctccgc      1080
     gggtatgacc agtccgccta cgacggcaag gattacatcg ccctgaacga ggatctgcgc      1140
     tcctggaccg ccgcggacac ggcggctcag atcacccagc gcaagtggga ggcggcccgt      1200
     gaggcggagc agctgagagc ctacctggag ggcctgtgcg tggagtggct ccgcagatac      1260
     ctgaagaatg ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc      1320
     ccatctcctg tagatctccc gggatggcct cccacgagga ggggaggaaa atgggatcag      1380
     cgctagaata tcgccctccc ttgaatggag aatgggatga gttttcctga gtttcctctg      1440
     agggccccct ctgctctcta ggacaattaa gggatgaagt ccttgaggaa atggagggga      1500
     agacagtccc tagaatactg atcaggggtc ccctttgacc actttgacca ctgcagcagc      1560
     tgtggtcagg ctgctgacct ttctctcagg ccttgttctc tgcctcacgc tcaatgtgtt      1620
     tgaaggtttg attccagctt ttctgagtcc ttcggcctcc actcaggtca ggaccagaag      1680
     tcgctgttcc tccctcagag actagaactt tccaatgaat aggagattat cccaggtgcc      1740
     tgtgtccagg ctggcgtctg ggttctgtgc ccccttcccc accccaggtg tcctgtccgt      1800
     tctcaggatg gtcacatggg cgctgttgga gtgtcgcaag agagatacaa agtgtctgaa      1860
     ttttctgact cttcccgtca gaacacccaa agacacacgt gacccaccat cccgtctctg      1920
     accatgaggc caccctgagg tgctgggccc tgggcttcta ccctgcggag atcacactga      1980
     cctggcagtg ggatggggag gaccaaactc aggacactga gcttgtggag accaggccag      2040
     caggagatgg aaccttccag aagtgggcag ctgtggtggt gccttctgga gaagagcaga      2100
     gatacacgtg ccatgtgcag cacgaggggc tgccggagcc cctcaccctg agatggggta      2160
     aggaggggga tgaggggtga tgtgtcttct cagggaaagc agaagtcctg gagcccttca      2220
     gccaggtcag ggctgaggct tgggggtcag ggcccctcac cttcccctcc tttcccagag      2280
     ccgtcttccc agcccaccat ccccatcgtg ggcatcgttg ctggcctggc tgtcctggct      2340
     gtcctagctg tcctaggagc tgtggtggct gttgtgatgt gtaggaggaa gagctcaggt      2400
     agggaagggg tgaggagtgg ggtctgggtt ttcttgttcc actgggagtt tcaagcccca      2460
     ggtagaagtg tgccccacct cgttactgga agcaccatcc acacatgggc catcccagcc      2520
     tgggaccctg tgtgccagca cttactctgt tgtgaagcac atgacaatga aggacagatg      2580
     tatcaccttg atgattatgg tgttggggtc cttgattcca gcattcatga gtcaggggaa      2640
     ggtccctgct aaggacagac cttaggaggg cagttgctcc agaacccaca gctgctttcc      2700
     ccgtgtttcc tgatcctgcc ctgggtctgc agtcatagtt ctggaaactt ctcttgggtc      2760
     caagactagg aggttcccct aagatcgcat ggccctgact cctccctgtc ccctcacagg      2820
     gcattttctt cccacaggtg gaaaaggagg gagctgctct caggctgcgt gtaagtgatg      2880
     gcggtgggcg tgtggaggag ctcacccacc ccataattcc tcttgtccca catctcctgc      2940
     gggctctgac caggtctttt tttttgttct accccagcca gcaacagtgc ccagggctct      3000
     gatgagtctc tcatcgcttg taaaggtgag attctgggga gctgaagtgg tcgggggtgg      3060
     ggcagaggga aaaggcctag gtaatgggga tcctttgatt gggacgtttc gaatgtgtgg      3120
     tgagctgttc agagtgtgat cacttaccat gactgacctg aatttgttca tgactattgt      3180
     gttctgtagc ctgagacagc tgcctgtgtg ggactgagat gcaggatttc ttcacacctc      3240
     tcctttgtga cttcaagagc ctctggcatc tctttctgca aaggcatctg aatgtgtctg      3300
     cgttcctgtt agcataatgt gaggaggtgg acagacagcc cacccccgtg tccaccgtga      3360
     cccctgtccc cacactgacc tgtgttccct ccccga                                3396
//