spacer

EBI Dbfetch

ID   AJ315641; SV 1; linear; genomic DNA; STD; HUM; 3200 BP.
XX
AC   AJ315641;
XX
DT   16-JUL-2001 (Rel. 68, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*01, exons 1-8
XX
KW   HLA-A gene; HLA-A*01 allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3200
RA   Cox S.T.;
RT   ;
RL   Submitted (18-JUN-2001) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Sequence of HLA-A*01XX";
RL   Unpublished.
XX
DR   MD5; dc4e43ae68910ed6397064c510cc6328.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3200
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..73,204..473,715..990,1570..1845,1948..2064,
FT                   2507..2539,2682..2729,2899..>2903)
FT                   /gene="HLA-A"
FT   CDS             join(1..73,204..473,715..990,1570..1845,1948..2064,
FT                   2507..2539,2682..2729,2899..2903)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /note="allele HLA-A*01"
FT                   /db_xref="GOA:Q95HA5"
FT                   /db_xref="IMGT/HLA:A*01:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95HA5"
FT                   /protein_id="CAC44381.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQLVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /number=1
FT   intron          74..203
FT                   /gene="HLA-A"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-A"
FT                   /number=2
FT   intron          474..714
FT                   /gene="HLA-A"
FT                   /number=2
FT   exon            715..990
FT                   /gene="HLA-A"
FT                   /number=3
FT   intron          991..1569
FT                   /gene="HLA-A"
FT                   /number=3
FT   exon            1570..1845
FT                   /gene="HLA-A"
FT                   /number=4
FT   intron          1846..1947
FT                   /gene="HLA-A"
FT                   /number=4
FT   exon            1948..2064
FT                   /gene="HLA-A"
FT                   /number=5
FT   intron          2065..2506
FT                   /gene="HLA-A"
FT                   /number=5
FT   exon            2507..2539
FT                   /gene="HLA-A"
FT                   /number=6
FT   intron          2540..2681
FT                   /gene="HLA-A"
FT                   /number=6
FT   exon            2682..2729
FT                   /gene="HLA-A"
FT                   /number=7
FT   intron          2730..2898
FT                   /gene="HLA-A"
FT                   /number=7
FT   exon            2899..>2903
FT                   /gene="HLA-A"
FT                   /number=8
XX
SQ   Sequence 3200 BP; 618 A; 910 C; 991 G; 681 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcggg agggaaaccg cctctgcggg gagaagcaag       120
     gggccctcct ggcgggggcg caggaccggg ggagccgcgc cgggaggagg gtcgggcagg       180
     tctcagccac tgctcgcccc caggctccca ctccatgagg tatttcttca catccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     agtgcggttc gacagcgacg ccgcgagcca gaagatggag ccgcgggcgc cgtggataga       360
     gcaggagggg ccggagtatt gggaccagga gacacggaat atgaaggccc actcacagac       420
     tgaccgagcg aacctgggga ccctgcgcgg ctactacaac cagagcgagg acggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tcatccccca cggacgggcc aggtcgccca       540
     cagtctccgg gtccgagatc caccccgaag ccgcggggct ccgagaccct tgtcccggga       600
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       660
     ggtcggggcg gggcggggct cgggggactg ggctgaccgc ggggtcgggg ccaggttctc       720
     acaccatcca gataatgtat ggctgcgacg tggggccgga cgggcgcttc ctccgcgggt       780
     accggcagga cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgcgctctt       840
     ggaccgcggc ggacatggca gctcagatca ccaagcgcaa gtgggaggcg gtccatgcgg       900
     cggagcagcg gagagtctac ctggagggcc ggtgcgtgga cgggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat      1020
     cgcctataga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcac cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1140
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1200
     ctgaaggagt gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacaccg      1260
     gcagcagcct tgggcccgtg acttttcctc tcaggccttg ttctctgctt cacactcaat      1320
     gtgtgtgggg gtctgagtcc agcacttctg agtctctcag cctccactca ggtcaggacc      1380
     agaagtcgct gttcccttct cagggaatag aagattatcc caggtgcctg tgtccaggct      1440
     ggtgtctggg ttctgtgctc tcttccccat cccgggtgtc ctgtccattc tcaagatggc      1500
     cacatgcgtg ctggtggagt gtcccatgac agatgcaaaa tgcctgaatt ttctgactct      1560
     tcccgtcaga cccccccaag acacatatga cccaccaccc catctctgac catgaggcca      1620
     ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1680
     atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca ggggatggaa      1740
     ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga tacacctgcc      1800
     atgtgcagca tgagggtctg cccaagcccc tcaccctgag atggggtaag gagggagatg      1860
     ggggtgtcat gtctcttagg gaaagcagga gcctctctgg agacctttag cagggtcagg      1920
     gcccctcacc ttcccctctt ttcccagagc tgtcttccca gcccaccatc cccatcgtgg      1980
     gcatcattgc tggcctggtt ctccttggag ctgtgatcac tggagctgtg gtcgctgccg      2040
     tgatgtggag gaggaagagc tcaggtggag aaggggtgaa gggtggggtc tgagatttct      2100
     tgtctcactg agggttccaa gccccagcta gaaatgtgcc ctgtctcatt actgggaagc      2160
     accttccaca atcatgggcc gacccagcct gggccctgtg tgccagcact tactcttttg      2220
     taaagcacct gttaaaatga aggacagatt tatcaccttg attacggcgg tgatgggacc      2280
     tgatcccagc agtcacaagt cacaggggaa ggtccctgag gacagacctc aggagggcta      2340
     ttggtccagg acccacacct gctttcttca tgtttcctga tcccgccctg ggtctgcagt      2400
     cacacatttc tggaaacttc tctggggtcc aagactagga ggttcctcta ggaccttaag      2460
     gccctggctc ctttctggta tctcacagga cattttcttc ccacagatag aaaaggaggg      2520
     agttacactc aggctgcaag taagtatgaa ggaggctgat gcctgaggtc cttgggatat      2580
     tgtgtttggg agcccatggg ggagctcacc caccccacaa ttcctcctct agccacatct      2640
     tctgtgggat ctgaccaggt tctgtttttg ttctacccca ggcagtgaca gtgcccaggg      2700
     ctctgatgtg tctctcacag cttgtaaagg tgagagcttg gagggcctga tgtgtgttgg      2760
     gtgttgggtg gaacagtgga cacagctgtg ctatggggtt tctttgcgtt ggatgtattg      2820
     agcatgcgat gggctgttta aggtgtgacc cctcactgtg atggatatga atttgttcat      2880
     gaatattttt ttctatagtg tgagacagct gccttgtgtg ggactgagag gcaagagttg      2940
     ttcctgccct tccctttgtg acttgaagaa ccctgacttt gtttctgcaa aggcacctgc      3000
     atgtgtctgt gttcgtgtag gcataatgtg aggaggtggg gagagtaccc cacccccatg      3060
     tccaccatga ccctcttccc acgctgacct gtgctccctc cccaaaagct tgcggaaggg      3120
     cgaattccag cacactggcg gccgttacta gtggatccga gctcggtacc aagcttgatg      3180
     catagcttga gtattctaac                                                  3200
//


spacer
spacer