spacer

EBI Dbfetch

ID   AJ315477; SV 1; linear; genomic DNA; STD; HUM; 246 BP.
XX
AC   AJ315477;
XX
DT   01-MAR-2002 (Rel. 70, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB3 gene for MHC class II, exon 2
XX
KW   antigen DR52; HLA-DRB3 gene; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-246
RA   Tavoularis S.;
RT   ;
RL   Submitted (27-JUL-2001) to the INSDC.
RL   Tavoularis S., HLA Laboratory, Canadian Blood Services, Head Office, 1800
RL   Alta Vista Drive, Ottawa, Ontario K1G 4J5, CANADA.
XX
RN   [2]
RA   Tavoularis S.;
RT   "Identification of a novel DRB3 allele using the CANTYPE assay";
RL   Unpublished.
XX
DR   MD5; 58bb616ff81055c3dc27dfd1f0cef337.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
DR   Ensembl-Tr; ENST00000426847; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..246
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>246
FT                   /codon_start=3
FT                   /gene="HLA-DRB3"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="antigen DR52"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*01:10"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="CAC86562.1"
FT                   /translation="RFLELRKSECHFFNGTERVRYLDRYFHNQEEFLSFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVG"
FT   exon            1..246
FT                   /gene="HLA-DRB3"
FT                   /number=2
XX
SQ   Sequence 246 BP; 51 A; 58 C; 90 G; 47 T; 0 other;
     cacgtttctt ggagctgcgt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagttcct gagcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaatta ctgcagacac aactacgggg       240
     ttggtg                                                                  246
//


spacer
spacer