spacer

EBI Dbfetch

ID   AJ313162; SV 1; linear; mRNA; STD; HUM; 1351 BP.
XX
AC   AJ313162;
XX
DT   21-OCT-2001 (Rel. 69, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens mRNA for soluble cytokine class II receptor, long isoform
DE   (CRF2-S1 gene)
XX
KW   alternative splicing; CRF2-S1 gene; long isoform;
KW   soluble cytokine class II receptor.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1351
RA   Weiss B.;
RT   ;
RL   Submitted (06-JUN-2001) to the INSDC.
RL   Weiss B., Genomics & Bioinformatics, Schering AG, Muellerstr. 178, Berlin,
RL   D-13342, GERMANY.
XX
RN   [2]
RX   DOI; 10.1038/sj.gene.6363786.
RX   PUBMED; 11607789.
RA   Gruenberg B.H., Schoenemeyer A., Weiss B., Toschi L., Kunz S., Wolk K.,
RA   Asadullah K., Sabat R.;
RT   "A novel, soluble homologue of the human IL-10 receptor with preferential
RT   expression in placenta";
RL   Genes Immun. 2(6):329-334(2001).
XX
DR   MD5; e7289756bf81a41fef95c5f785f4e45f.
DR   Ensembl-Gn; ENSG00000164485; homo_sapiens.
DR   Ensembl-Tr; ENST00000296980; homo_sapiens.
DR   Ensembl-Tr; ENST00000339602; homo_sapiens.
DR   Ensembl-Tr; ENST00000349184; homo_sapiens.
DR   EuropePMC; PMC2008291; 17725822.
XX
CC   Related sequence AJ313161: short isoform
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1351
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q241.-25.2"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /tissue_lib="Clontech Human Placenta #64024-1"
FT                   /tissue_type="placenta"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..303
FT                   /gene="CRF2-S1"
FT   CDS             304..1095
FT                   /gene="CRF2-S1"
FT                   /product="soluble cytokine class II receptor, long isoform"
FT                   /db_xref="GOA:Q969J5"
FT                   /db_xref="H-InvDB:HIT000247133.11"
FT                   /db_xref="HGNC:HGNC:14901"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015373"
FT                   /db_xref="PDB:3G9V"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q969J5"
FT                   /protein_id="CAC85635.1"
FT                   /translation="MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNIL
FT                   QWQPGRALTGNSSVYFVQYKIMFSCSMKSSHQKPSGCWQHISCNFPGCRTLAKYGQRQW
FT                   KNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPP
FT                   VMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGA
FT                   HRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP"
FT   sig_peptide     304..366
FT                   /gene="CRF2-S1"
FT   mat_peptide     367..1092
FT                   /gene="CRF2-S1"
FT                   /product="soluble cytokine class II receptor, long isoform"
FT   3'UTR           1096..1351
FT                   /gene="CRF2-S1"
XX
SQ   Sequence 1351 BP; 429 A; 276 C; 267 G; 379 T; 0 other;
     aactcacttt accactactc gctatagagc cctggtcaag ttctctccac ctctctatct        60
     atgtctcagt ttcttcatct gtaacatcaa atgaataata ataccaatct cctagacttc       120
     ataagaggat taacaaagac aaaatatggg aaaaacataa catggcgtcc cataattatt       180
     agatcttatt attgacacta aaatggcatt aaaattacca aaaggaagac agcatctgtt       240
     tcctctttgg tcctgagctg gttaaaagga acactggttg cctgaacagt cacacttgca       300
     accatgatgc ctaaacattg ctttctaggc ttcctcatca gtttcttcct tactggtgta       360
     gcaggaactc agtcaacgca tgagtctctg aagcctcaga gggtacaatt tcagtcccga       420
     aattttcaca acattttgca atggcagcct gggagggcac ttactggcaa cagcagtgtc       480
     tattttgtgc agtacaaaat catgttctca tgcagcatga aaagctctca ccagaagcca       540
     agtggatgct ggcagcacat ttcttgtaac ttcccaggct gcagaacatt ggctaaatat       600
     ggacagagac aatggaaaaa taaagaagac tgttggggta ctcaagaact ctcttgtgac       660
     cttaccagtg aaacctcaga catacaggaa ccttattacg ggagggtgag ggcggcctcg       720
     gctgggagct actcagaatg gagcatgacg ccgcggttca ctccctggtg ggaaacaaaa       780
     atagatcctc cagtcatgaa tataacccaa gtcaatggct ctttgttggt aattctccat       840
     gctccaaatt taccatatag ataccaaaag gaaaaaaatg tatctataga agattactat       900
     gaactactat accgagtttt tataattaac aattcactag aaaaggagca aaaggtttat       960
     gaaggggctc acagagcggt tgaaattgaa gctctaacac cacactccag ctactgtgta      1020
     gtggctgaaa tatatcagcc catgttagac agaagaagtc agagaagtga agagagatgt      1080
     gtggaaattc catgacttgt ggaatttggc attcagcaat gtggaaattc taaagctccc      1140
     tgagaacagg atgactcgtg tttgaaggat cttatttaaa attgtttttg tattttctta      1200
     aagcaatatt cactgttaca ccttggggac ttctttgttt acccattctt ttatccttta      1260
     tatttcattt gtaaactata tttgaacgac attccccccg aaaaattgaa atgtaaagat      1320
     gaggcagaga ataaagtgtt ctatgaaatg c                                     1351
//


spacer
spacer