spacer

EBI Dbfetch

ID   AJ312287; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   AJ312287;
XX
DT   14-JUN-2001 (Rel. 68, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, new B*35 allele,
DE   exons 2-3
XX
KW   HLA-B gene; human leucocyte antigen B; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RA   Witter K.;
RT   ;
RL   Submitted (12-JUN-2001) to the INSDC.
RL   Witter K., Labor of Immunogenetics, University Munich, Paul-Heyse Strasse
RL   33, 80336 Munich, GERMANY.
XX
RN   [2]
RA   Witter K., Zahn R., McNicolas A., Scholz S., Albert E.;
RT   "A novel HLA-B35 allele found in a routine sample DNA";
RL   Unpublished.
XX
DR   MD5; a2ddbf2a654a14bff1288845ddbabc6c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:Q95IE0"
FT                   /db_xref="IMGT/HLA:B*35:38"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IE0"
FT                   /protein_id="CAC41989.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT   intron          271..516
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            517..>792
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 792 BP; 143 A; 264 C; 279 G; 106 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggact ggggctgacc gcggggccgg ggccagggtc tcacatcatc cagaggatgt       540
     atggctgcga cctggggccc gacgggcgcc tcctccgcgg gcatgaccag ttcgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgagctc ctggaccgcg gcggacaccg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag gacagagcct       720
     acctggaggg cctgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc gg                                                           792
//


spacer
spacer