Dbfetch

ID   AJ311892; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ311892;
XX
DT   26-JUL-2001 (Rel. 68, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*07
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*07 allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Cohen J.H.M.;
RT   ;
RL   Submitted (19-JUL-2001) to the INSDC.
RL   Cohen J.H.M., Laboratoire d'Immunologie G.E. DROPSY, CHU REIMS EA 33 09 IFR
RL   53 URCA Medecine, avenue du general Koenig, 51092 REIMS, FRANCE.
XX
RN   [2]
RA   Donvito B., Dormoy A., Perrier P., Tabary T., Tongio M., Cohen J.H.M.;
RT   "A New HLA-DRB*07 allele identified using microlymphocytotoxicity";
RL   Unpublished.
XX
DR   MD5; 497c2d7faca55994affe178adb2dda2e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="HLA-DRB1*07 allele"
FT                   /db_xref="GOA:Q95IE2"
FT                   /db_xref="IMGT/HLA:DRB1*07:06"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IE2"
FT                   /protein_id="CAC44767.1"
FT                   /translation="RFLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAV
FT                   TELGRPAAEYWNSQKDILEDRRGQVDTVCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 59 A; 61 C; 101 G; 49 T; 0 other;
     cacgtttcct gtggcagggt aagtataagt gtcatttctt caacgggacg gagcgggtgc        60
     agttcctgga aagactcttc tataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctagggc ggcctgctgc ggagtactgg aacagccaga       180
     aggacatcct ggaggacagg cggggccagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//