Dbfetch

ID   AJ311601; SV 2; linear; genomic DNA; STD; HUM; 3448 BP.
XX
AC   AJ311601;
XX
DT   29-MAR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, B*7301 allele, exons 1-7
XX
KW   HLA-B gene; HLA-B*7301 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Cox S.T.;
RT   ;
RL   Submitted (01-MAR-2001) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Confirmation of HLA-B*7301";
RL   Unpublished.
XX
RN   [3]
RP   1-3448
RA   Cox S.T.;
RT   ;
RL   Submitted (08-OCT-2004) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
DR   MD5; 55bb10a6e653d7c58de1a151a13d0351.
DR   EPD; EP73522; HS_HLA-B.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3448
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /note="confirmation of HLA B*7301 from cell LK707"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..301
FT   mRNA            join(<302..374,503..772,1018..1293,1867..2142,2247..2363,
FT                   2808..2840,2947..>2990)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="B*7301 allele"
FT   CDS             join(302..374,503..772,1018..1293,1867..2142,2247..2363,
FT                   2808..2840,2947..2990)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="B*7301 allele"
FT                   /db_xref="GOA:Q31612"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*73:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q31612"
FT                   /protein_id="CAC35319.2"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKAKAQTDRVGLRN
FT                   LRGYYNQSEDGSHTWQTMYGCDMGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRHLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLQEPCTLRWKPSSQSTIPIVGIVAGLAVLVVTVAVVAVVAAVMCRRKSCGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            302..374
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*7301 allele"
FT   intron          375..502
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*7301 allele"
FT   exon            503..772
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*7301 allele"
FT   intron          773..1017
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*7301 allele"
FT   exon            1018..1293
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*7301 allele"
FT   intron          1294..1866
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*7301 allele"
FT   exon            1867..2142
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*7301 allele"
FT   intron          2143..2246
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*7301 allele"
FT   exon            2247..2363
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*7301 allele"
FT   intron          2364..2807
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*7301 allele"
FT   exon            2808..2840
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*7301 allele"
FT   intron          2841..2946
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*7301 allele"
FT   exon            2947..2990
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="B*7301 allele"
FT   3'UTR           2991..3448
XX
SQ   Sequence 3448 BP; 642 A; 1000 C; 1083 G; 723 T; 0 other;
     tggtgtagga gaagagggat caggacgaag tcccaggtcc cggacggggc tctcagggtc        60
     tcaggctccg agggccgcgt ctgcaatggg gaggcgcagc gttggggatt ccccactccc       120
     ctgagtttca cttcttctcc caacttgtgt cgggtccttc ttccaggata ctcgtgacgc       180
     gtccccactt cccactccca ttgggtgtcg gatatctaga gaagccaatc agcgttgccg       240
     cggtcccagt tctaaagtcc ccacgcaccc acccggactc agagtctcct cagacgccga       300
     gatgctggtc atggcgcccc gaaccgtcct cctgctgctc tcggcggccc tggccctgac       360
     cgagacctgg gccggtgagt gcgggtcggg agggaaatgg cctctgccgg gaggagcgag       420
     gggaccgcag gcgggggcgc aggacccggg gagccgcgcc ggtaggaggg tcgggcgggt       480
     ctcagcccct cctcgccccc aggctcccac tccatgaggt atttccacac ctccgtgtcc       540
     cggcctggcc gcggggagcc ccgcttcatc accgtgggct acgtggacga cacccagttc       600
     gtgaggttcg acagcgacgc cgcgagtccg agagaggagc cgcgggcgcc gtggatagag       660
     caggaggggc cggagtattg ggaccggaac acacagatct gcaaggccaa ggcacagact       720
     gaccgagtgg gcctgcggaa cctgcgcggc tactacaacc agagcgagga cggtgagtga       780
     ccccggcctg gggcgcaggt cacgacccct ccccaacccc gacgtacggc ccgggtctcc       840
     tcgagtctct aggtccgaga tccgccccga ggccgcggga cccgcccaga acctcgaccg       900
     cagagagccc caggcgactt tacccggttt cattttcagt tgaggtcaaa atccccgcgg       960
     gttggtcggg gcggggcggg gctcggggga ctgggctgac cgcgagggct gggccagggt      1020
     ctcacacttg gcagacgatg tatggctgcg acatggggcc ggacgggcgc ctcctccgcg      1080
     ggtataacca gttcgcctac gacggcaagg attacatcgc cctgaacgag gacctgcgct      1140
     cctggaccgc cgcggacacg gcggctcaga tcacccagcg caagtgggag gcggcccgtg      1200
     tggcggagca gctgagagcc tacctggagg gcgagtgcgt ggagtggctc cgcagacacc      1260
     tggagaacgg gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc      1320
     catctcctat agatcgcccg ggatggcctc ccacgaggag gggaggaaaa tgagagaagc      1380
     gctagaatgt cgccctccct tgaatggaga atggcatgag ttttcctgag tttcctctga      1440
     gggccccctc tgctgtctag gacaattaag ggatgacatc tctgaggaaa tggaggggaa      1500
     gacagtccct agaatactga tcaggtgtcc cctttgaccc ctgcagcagc cttgggcacc      1560
     gtgacttttc ctctcaggcc ttgttctctg ccccacactc agtgtttggg gctctgattc      1620
     cagcacttct gagtcacttt acctctactc agatcaggag cagaagtccc tgttccccgc      1680
     tcagagactc gaactttcca atgaatagga gattatccca ggtgcctgtg tccaggctgg      1740
     tgtctgggtt ctgtgcccct tccccacccc aggtgtcctg tccattctca ggctggtcac      1800
     atgggtggtc ctagggtgtc ccatgagaga tgcaaagcgc ctgaattttc tgactcttcc      1860
     catcagaccc cccaaagaca cacgtgaccc accaccccat ctctgaccat gaggccaccc      1920
     tgaggtgctg ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg      1980
     gcgaggacca aactcaggac accgagcttg tggagaccag gccagcagga gatggaacct      2040
     tccagaagtg ggcagctgtg gtggtgcctt ctggacaaga acagagatac acgtgccatg      2100
     tgcagcacga ggggctgcag gagccctgca ccctgagatg gagtaaggag ggggatgagg      2160
     ggtcatatct cttctcaggg aaagcaggag cccttctgga gcccttcagc agggtcgggg      2220
     cccctcatct tcccctcctt tcccagagcc atcttcccag tccaccatcc ccatcgtggg      2280
     cattgttgct ggcctggctg tccttgtggt caccgtagct gtggtcgctg tggtcgctgc      2340
     tgtgatgtgt aggaggaaga gctcaggtag ggaaggggtg aggggtgggg tctgggtttt      2400
     gttgtcccac tgggggtttc aagccccagg tagaagtgtt ccctgcctca ttactgggaa      2460
     gcagcatcca cacaggggct aacgcagcct ggggccctgt gtgccagcac ttactctttt      2520
     gtgcagcaca tgtgacaatg aaagacggat gtatcacctt aatggttgtg gtgttggggt      2580
     cctgattcca gcattcatga gtcaggggaa ggtccctgct aaggacagac cttaggaggg      2640
     cagttggtcc aggacccaca cttgctttcc ttgtgtttcc tgatcctgcc ctgggtctgt      2700
     agtcatactt ctggaaattc cttttgggtc caagacgagg aggttcctct aagatctcat      2760
     ggccctgctt cctcccagtc ccctcacagg acattttctt cccacaggtg gaaaaggagg      2820
     gagctactct caggctgcgt gtaagtggtg ggggtgggag tgtggaggag ctcacccacc      2880
     ccataattcc tcctgtccaa cgtctcctgc gggctctgac caggtcctgt ttttgttcta      2940
     ctccagccag cgacagtgcc cagggctctg atgtgtctct cacagcttga aaaggtgaga      3000
     ttcttggggt ctagagtggg caggggggtg gtggggcaga ggggaaaggc ctgggtaatg      3060
     gagattcttt gattgggatg tttcgcgtgt gtggtgggcc gttcagagtg tcatcactta      3120
     ccatgactaa ccagaatttg ttcatgactg ttgttttctg tagcctgaga cagctgtctt      3180
     gtgagggact gagatgcagg atttcttcac gcctcccctt tgtgacttca agagcctctg      3240
     gcatctcttt ctgcaaaggc acctgaatgt gtctgcgtcc ctgttagcat aatgtgagga      3300
     ggtggagaga cagcccaccc ccgtgtccac cgtgacccct gttcgcatgc tgacctgtgt      3360
     ttcctcccca gaagcttgcg gaagggcgaa ttccagcaca ctggcggccg ttactagtgg      3420
     atccgagctc ggtaccaagc ttgatgca                                         3448
//