spacer

EBI Dbfetch

ID   AJ311600; SV 2; linear; genomic DNA; STD; HUM; 3387 BP.
XX
AC   AJ311600;
XX
DT   29-MAR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele B*4901, exons 1-7
XX
KW   HLA-B gene; HLA-B*4901 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Cox S.T.;
RT   ;
RL   Submitted (01-MAR-2001) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Confirmation of HLA-B*4901";
RL   Unpublished.
XX
RN   [3]
RP   1-3387
RA   Cox S.T.;
RT   ;
RL   Submitted (12-NOV-2004) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
DR   MD5; be744974475e6f888dc3bd55e941a650.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3387
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /note="confirmation of HLA B*4901 from cell AM"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<302..374,503..772,1023..1298,1874..2149,2254..2370,
FT                   2812..2844,2951..>2994)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="B*4901 allele"
FT   CDS             join(302..374,503..772,1023..1298,1874..2149,2254..2370,
FT                   2812..2844,2951..2994)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /note="B*4901 allele"
FT                   /db_xref="GOA:Q5TK75"
FT                   /db_xref="IMGT/HLA:B*49:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5TK75"
FT                   /protein_id="CAC35318.1"
FT                   /translation="MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRI
FT                   ALRYYNQSEAGSHTWQRMYGCDLGPDGRLLRGYNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            302..374
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*4901 allele"
FT   intron          375..502
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*4901 allele"
FT   exon            503..772
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*4901 allele"
FT   intron          773..1022
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*4901 allele"
FT   exon            1023..1298
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*4901 allele"
FT   intron          1299..1873
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*4901 allele"
FT   exon            1874..2149
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*4901 allele"
FT   intron          2150..2253
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*4901 allele"
FT   exon            2254..2370
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*4901 allele"
FT   intron          2371..2811
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*4901 allele"
FT   exon            2812..2844
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*4901 allele"
FT   intron          2845..2950
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*4901 allele"
FT   exon            2951..2994
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="B*4901 allele"
XX
SQ   Sequence 3387 BP; 626 A; 985 C; 1064 G; 712 T; 0 other;
     tggtgtagga gaagagggat caggacgaag tcccaggccc cgggcggggc tctcagggtc        60
     tcaggctccg agggccgcgt ctgcaatggg gaggcgcagc gttggggatt ccccactccc       120
     acgagtttca cttcttctcc caacctatgt cgggtccttc ttccaggata ctcgtgacgc       180
     gtccccattt cccactccca ttgggtgtcg ggtgtctaga gaagccaatc agcgtcgccg       240
     tggtcccagt tctaaagtcc ccacgcaccc acccggactc agaatctcct cagacgccga       300
     gatgcgggtc acggcacccc gaaccgtcct cctgctgctc tcggcggccc tggccctgac       360
     cgagacctgg gccggtgagt gcgggtcggc agggaaatgg cctctgtggg gaggagcgag       420
     gggaccgcag gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt       480
     ctcagcccct cctcgccccc aggctcccac tccatgaggt atttccacac cgccatgtcc       540
     cggcccggcc gcggggagcc ccgcttcatc accgtgggct acgtggacga cacgctgttc       600
     gtgaggttcg acagcgacgc cacgagtccg aggaaggagc cgcgggcgcc atggatagag       660
     caggaggggc cggagtattg ggaccgggag acacagatct ccaagaccaa cacacagact       720
     taccgagaga acctgcggat cgcgctccgc tactacaacc agagcgaggc cggtgagtga       780
     ccccggcccg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       840
     agtctccggg tccgagatcc gcccccctga ggccgcggga cccgcccaga ccctcgaccg       900
     gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg       960
     gttggtcggg gcggggcggg gcggggctcg ggggacgggg ctgaccgcgg ggcctgggcc      1020
     agggtctcac acttggcaga ggatgtatgg ctgcgacctg gggcccgacg ggcgcctcct      1080
     ccgcgggtat aaccagttag cctacgacgg caaggattac atcgccctga acgaggacct      1140
     gagctcctgg accgcggcgg acaccgcggc tcagatcacc cagcgcaagt gggaggcggc      1200
     ccgtgaggcg gagcagctga gagcctacct ggagggcctg tgcgtggagt ggctccgcag      1260
     atacctggag aacgggaagg agacgctgca gcgcgcgggt accaggggca gtggggagcc      1320
     ttccccatct cctataggtc gccggggatg gcctcccacg agaagaggag gaaaatggga      1380
     tcagcgctag aatgtcgccc tcccttgaat ggagaatggc atgagttttc ctgagtttcc      1440
     tctgagggcc ccctcttctc tctaggacaa ttaagggatg acgtctctga ggaaatggag      1500
     gggaagacag tccctagaat actgatcagg ggtccccttt gacccctgca gcagccttgg      1560
     gaaccgtgac ttttcctctc aggccttgtt ctctgcctca cactcagtgt gtttggggct      1620
     ctgattccag cacttctgag tcactttacc tccactcaga tcaggagcag aagtccctgt      1680
     tccccactca gagactcgaa ctttccaatg aataggagat tatcccaggt gcctgcgtcc      1740
     aggctggtgt ctgggttctg tgccccttcc ccaccccagg tgtcctgtcc attctcaggc      1800
     tggtcacatg ggtggtccta gggtgtccca tgagagatgc aaagcgcctg aattttctga      1860
     ctcttcccat cagacccccc aaagacacat gtgacccacc accccatctc tgaccatgag      1920
     gccaccctga ggtgctgggc cctgggcttc taccctgcgg agatcacact gacctggcag      1980
     cgggatggcg aggaccaaac tcaggacacc gagcttgtgg agaccagacc agcaggagat      2040
     agaaccttcc agaagtgggc agctgtggtg gtgccttctg gagaagagca gagatacaca      2100
     tgccatgtac agcatgaggg gctgccgaag cccctcaccc tgagatgggg taaggagggg      2160
     gatgaggggt catatctgtt ctcagggaaa gcaggagccc ttctggagcc cttcagcagg      2220
     gtcagggccc ctcatcttcc cctcctttcc cagagccatc ttcccagtcc accatcccca      2280
     tcgtgggcat tgttgctggc ctggctgtcc tagcagttgt ggtcatcgga gctgtggtcg      2340
     ctactgtgat gtgtaggagg aagagctcag gtagggaagg ggtgaggggt ggggtctggg      2400
     ttttcttgtc ccactggggg tttcaagccc caggtagaag tgttccctgc ctcattactg      2460
     ggaagcagca tccacacagg ggctaacgca gcctgggacc ctgtgtgcca gcacttactc      2520
     ttttgtgcag cacatgtgac aatgaaggac ggatgtatcg ccttgatggt tgtggtgttg      2580
     gggtcctgat tccagcattc atgagtcagg ggaaggtccc tgctaaggac agaccttagg      2640
     agggcagttg gtccaggacc cacacttgct ttcctcgtgt ttcctgatcc tgccttgggt      2700
     ctgtagtcat acttctggaa attccttttg gttccaagac gaggaggttc ctctaagatc      2760
     tcatggccct gcttcctccc agtcccctca caggacattt tcttcccaca ggtggaaaag      2820
     gagggagcta ctctcaggct gcgtgtaagt ggtgggggtg ggagtgtgga ggagctcacc      2880
     caccccataa ttcctcctgt cccacgtctc ctgagggctc tgaccaggtc ctgtttttgt      2940
     tctactccag ccagcgacag tgcccagggc tctgatgtgt ctctcacagc ttgaaaaggt      3000
     gagattcttg gggtctagag tgggtggggt ggcgggtctg ggggtgggtg gggcagtggg      3060
     gaaaggcctg ggtaatggag attctttgat tgggatgttt cgcgtgtgtg gtgggctgtt      3120
     cagagtgtca tcacttacca tgactaacca gaatttgttc atgactgttg ttttctgtag      3180
     cctgagacag ctgtcttgtg agggactgag atgcaggatt tcttcacgcc tcccctttgt      3240
     gacttcaaga gcctctggca tctctttctg caaaggcacc tgaatgtgtc tgcgtccctg      3300
     ttagcataat gtgaggaggt ggagagacag cccacccttg tgtccactgt gacccctgtt      3360
     cgcatgctga cctgtgtttc ctcccca                                          3387
//


spacer
spacer