spacer

EBI Dbfetch

ID   AJ311257; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   AJ311257;
XX
DT   15-MAY-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, exons 2-3
XX
KW   HLA-B gene; human leucocyte antigen B; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Vidal S.;
RT   ;
RL   Submitted (11-MAY-2001) to the INSDC.
RL   Vidal S., Immunology, Hospital Sant Pau, Pare Claret, 167 Barcelona, 08025,
RL   SPAIN.
XX
RN   [2]
RA   Morante M., Mosquera A.M., Querol S., Garcia J., Rodriguez-Sanchez J.L.,
RA   Vidal S.;
RT   "Nucleotide sequence of a novel HLA-B allele";
RL   Unpublished.
XX
DR   MD5; 1a56daaa0d438643a6e47fc4a6c2449e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-B"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:Q95IT5"
FT                   /db_xref="IMGT/HLA:B*07:26"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IT5"
FT                   /protein_id="CAC38863.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT   intron          271..515
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            516..>791
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 791 BP; 141 A; 263 C; 284 G; 103 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggact gggctgaccg cggggccggg gccagggtct cacaccctcc agagcatgta       540
     cggctgcgac gtggggccgg acgggcgcct cctccgcggg catgaccagt acgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgcgctcc tggaccgccg cggacacggc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagc tgagagccta       720
     cctggagggc gagtgcgtgg agtggctccg cagatacctg gagaacggga aggacaagct       780
     ggagcgcgct g                                                            791
//


spacer
spacer