spacer

EBI Dbfetch

ID   AJ311158; SV 1; linear; genomic DNA; STD; ROD; 1217 BP.
XX
AC   AJ311158;
XX
DT   03-MAY-2002 (Rel. 71, Created)
DT   01-MAY-2007 (Rel. 91, Last updated, Version 3)
XX
DE   Apodemus mystacinus partial irbp gene for Inter Retinoid Binding protein
DE   tissue library JRM-261
XX
KW   Inter Retinoid Binding protein; IRBP gene.
XX
OS   Apodemus mystacinus (broad-toothed field mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Apodemus; Sylvaemus group.
XX
RN   [1]
RP   1-1217
RA   Michaux J.R.;
RT   ;
RL   Submitted (03-MAY-2001) to the INSDC.
RL   Michaux J.R., Labo paleontologie cc064, Universite de Montpellier, pl. E.
RL   Bataillon, 34095 cedex 5, FRANCE.
XX
RN   [2]
RA   Michaux J.R., Chevret P., Filippucci M.G., Macholan M.;
RT   "Phylogeny of the genus Apodemus with a special emphasis to the subgenus
RT   Sylvaemus using two mitochondrial genes cytchrome b and 12s rRNA";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1016/S1055-7903(02)00007-6.
RX   PUBMED; 12069545.
RA   Michaux J.R., Chevret P., Filippucci M.G., Macholan M.;
RT   "Phylogeny of the genus Apodemus with a special emphasis on the subgenus
RT   Sylvaemus using the nuclear IRBP gene and two mitochondrial markers:
RT   cytochrome b and 12S rRNA";
RL   Mol. Phylogenet. Evol. 23(2):123-136(2002).
XX
DR   MD5; feb04799b996308310b055bf3f650c6b.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1217
FT                   /organism="Apodemus mystacinus"
FT                   /mol_type="genomic DNA"
FT                   /country="Syria"
FT                   /tissue_lib="JRM-261"
FT                   /db_xref="taxon:100382"
FT   CDS             <1..>1217
FT                   /codon_start=1
FT                   /gene="irbp"
FT                   /product="Inter Retinoid Binding protein"
FT                   /db_xref="GOA:Q8K1M1"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K1M1"
FT                   /protein_id="CAC85064.1"
FT                   /translation="TGYEESEILGISDPQTLARVLTAGVQSSLNDPRLFISYEPSSLET
FT                   PQQAPALTNLTREELLAQIQKNIHHEVLEGNVGYLRVDDLPGQEVLSELGEFLVSHVWK
FT                   QLMGTSSLVLDLRHCAGGHVSGIPYVISYLHPGNTVMHVDTIYDRPSNTTTEIWTLPKV
FT                   LGERYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSN
FT                   FFLTVPVPRSLGPLGGGGQTWEGSGVLPCVGIPAEQALEKALAILTLRRALPGVVLRLQ
FT                   EALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPRLLVRATGPR
FT                   EASSRPESGPNEPPAATPEVPKEEDARRALVDSVFQVSVLPGNVGYLRFDRFADASVLR
FT                   TLGPYVL"
XX
SQ   Sequence 1217 BP; 243 A; 361 C; 364 G; 249 T; 0 other;
     acaggctatg aagagtctga gatcctgggt atctcagacc ctcagacgct ggcccgcgtg        60
     ctgacggctg gagtacagag ctccttgaat gacccacgtc tcttcatctc ttatgagccc       120
     agtagcctcg agactcccca gcaagctcca gcgctcacca acctcacccg agaagaactg       180
     ctggcccaga tacagaagaa cattcaccat gaggtgcttg agggcaacgt gggctacctg       240
     cgggtggatg acctccctgg ccaggaggta ctgagtgagc tgggggagtt cttagtgagc       300
     catgtgtgga agcaactcat gggcacctcc tccttggtgc tagatctccg gcactgcgct       360
     ggcggccacg tctctgggat cccttatgtc atctcttact tgcaccctgg gaacactgtc       420
     atgcacgtgg ataccatcta tgatcgtccc tccaacacca ccacagagat ctggaccttg       480
     cccaaggtcc taggggagag atacagtgct gacaaggacg tggtggtcct caccagtgga       540
     cataccgggg gagtcgctga ggacatcgcc tacatcctca agcagatgcg cagggccatc       600
     gtggtgggtg agcggacgga gggtggcgcc ctggacctcc agaagctgag aataggccag       660
     tccaacttct tcctcacagt gcctgttccg aggtccctgg gacccctggg tggaggcggc       720
     cagacatggg aaggcagtgg agtgctgccc tgtgtgggga tccctgcaga gcaagcccta       780
     gagaaggccc tggccatcct cactctgcgt cgggccctgc ctggtgttgt cctccgactt       840
     caggaagccc tccaggacta ttacacatta gtggaccgag ttccgggcct gctgcaccac       900
     ctggctagca tggactactc agccgtggtc tctgaagagg acctggtgac aaagctcaat       960
     gctggcttgc aggctgtgtc ggaggatccc aggctcctgg tgagagccac tggacccaga      1020
     gaagcctcct ccagacctga gtctgggcct aatgagcccc cagcagccac ccctgaggtg      1080
     cccaaggaag aagatgctcg aagggccctt gtggactctg tgtttcaggt gtccgtgctg      1140
     ccgggcaatg tgggctacct gcgctttgac agatttgcag acgcctctgt gctgaggacc      1200
     ctgggccctt atgtgct                                                     1217
//


spacer
spacer