spacer

EBI Dbfetch

ID   AJ310508; SV 1; linear; genomic DNA; STD; HUM; 3461 BP.
XX
AC   AJ310508;
XX
DT   17-MAR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele B*4601 exons 1-7
XX
KW   B*4601 allele; HLA-B gene; human leukocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3461
RA   Cox S.T.;
RT   ;
RL   Submitted (14-FEB-2001) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "confirmation of HLA-B*4601";
RL   Unpublished.
XX
DR   MD5; 2a0d77814a57cbc8f9cf015ca87b7566.
DR   EPD; EP73522; HS_HLA-B.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3461
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(302..374,504..773,1019..1294,1870..2145,2250..2366,
FT                   2808..2840,2947..2990)
FT                   /gene="HLA-B"
FT                   /note="B*4601"
FT   CDS             join(302..374,504..773,1019..1294,1870..2145,2250..2366,
FT                   2808..2840,2947..2990)
FT                   /gene="HLA-B"
FT                   /product="human leukocyte antigen B"
FT                   /function="antigen presentation"
FT                   /note="B*4601"
FT                   /db_xref="GOA:P30484"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*46:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:4LCY"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30484"
FT                   /protein_id="CAC34573.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            302..374
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*4601"
FT   intron          375..503
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*4601"
FT   exon            504..773
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*4601"
FT   intron          774..1018
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*4601"
FT   exon            1019..1294
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*4601"
FT   intron          1295..1869
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*4601"
FT   exon            1870..2145
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*4601"
FT   intron          2146..2249
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*4601"
FT   exon            2250..2366
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*4601"
FT   intron          2367..2807
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*4601"
FT   exon            2808..2840
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*4601"
FT   intron          2841..2946
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*4601"
FT   exon            2947..2990
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="B*4601"
XX
SQ   Sequence 3461 BP; 637 A; 1001 C; 1096 G; 727 T; 0 other;
     tggtgtagga gaagagggat caggacgaag tcccaggtcc cggacggggc tctcagggtc        60
     tcaggctccg agagccttgt ctgcattggg gaggcgcagc gttggggatt ccccactccc       120
     acgagtttca cttcttctcc caacctatgt cgggtccttc ttccaggata ctcgtgacgc       180
     gtccccattt cccactccca ttgggtgtcg ggtgtctaga gaagccaatc agtgtcgccg       240
     gggtcccagt tctaaagtcc ccacgcaccc acccggactc agagtctcct cagacgccga       300
     gatgcgggtc acggcgcccc gaaccgtcct cctgctgctc tcgggagccc tggccctgac       360
     cgagacctgg gccggtgagt gcggggtcgg cagggaaatg gcctctgtgg ggaggagcga       420
     ggggaccgca ggcgggggcg caggacccgg ggagccgcgc cgggaggagg gtcgggcggg       480
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttctaca ccgccatgtc       540
     ccggcccggc cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacccagtt       600
     cgtgaggttc gacagcgacg ccgcgagtcc gaggatggcg ccccgggcgc catggataga       660
     gcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac       720
     tgaccgagtg agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccggtgagtg       780
     accccggcct ggggcgcagg tcacgactcc ccatccccca cgtacggccc gggtcgcccc       840
     gagtctccgg gtccgagatc cgcccccctg aggccgcggg acccgcccaa accctcgacc       900
     ggcgagagcc ccaggcgcgt ttacccggtt tcattttcag ttgaggccaa aatccccgcg       960
     ggttggtcgg ggcggggcgg ggctcggggg acggggctga ccgcggggcc tgggccaggg      1020
     tctcacaccc tccagaggat gtacggctgc gacgtggggc cggacgggcg cctcctccgc      1080
     gggcatgacc agtccgccta cgacggcaag gattacatcg ccctgaacga ggacctgagc      1140
     tcctggaccg cggcggacac ggcggctcag atcacccagc gcaagtggga ggcggcccgt      1200
     gaggcggagc agtggagagc ctacctggag ggcctgtgcg tggagtggct ccgcagatac      1260
     ctggagaacg ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc      1320
     ccatctccta taggtcgccg gggatggcct cccacgagaa gaggaggaaa atgggatcag      1380
     cgctagaatg tcgccctccc ttgaatggag aatggcatga gttttcctga gtttcctctg      1440
     agggccccct cttctctcta ggacaattaa gggatgacgt ctctgaggaa atggagggga      1500
     agacagtccc taggatagtg atcaggggtc ccctttgacc cctgcagcag ccttgggaac      1560
     cgtgactttt cctctcaggc cttgttctct gcctcacact cagtgtgttt ggggctctga      1620
     ttccagcact tctgagtcac tttacctcca ctcagatcag gagcagaagt ccctgttccc      1680
     cgctcagaga ctcgaacttt ccaatgaata ggagattatc ccaggtgcct gcgtccaggc      1740
     tggtgtctgg gttctgtgcc ccttccccac cccaggtgtc ctgtccattc tcaggctggt      1800
     cacatgggtg gtcctagggt gtcccatgag agatgcaaag cgcctgaatt ttctgactct      1860
     tcccatcaga ccccccaaag acacatgtga cccaccaccc catctctgac catgaggcca      1920
     ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1980
     atggcgagga ccaaactcag gacaccgagc ttgtggagac cagaccagca ggagatagaa      2040
     ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga tacacatgcc      2100
     atgtacagca tgaggggctg ccgaagcccc tcaccctgag atggggtaag gagggggatg      2160
     aggggtcata tctgttctca gggaaagcag gagcccttct ggagcccttc agcagggtca      2220
     gggcccctca tcttcccctc ctttcccaga gccatcttcc cagtccacca tccccatcgt      2280
     gggcattgtt gctggcctgg ctgtcctagc agttgtggtc atcggagctg tggtcgctac      2340
     tgtgatgtgt aggaggaaga gctcaggtag ggaaggggtg aggggtgggg tctgggtttt      2400
     cttgtcccac tgggggtttc aagccccagg tagaagtgtt ccctgcctca ttactgggaa      2460
     gcagcatcca cacaggggct aacgcagcct gggaccctgt gtgccagcac ttactctttt      2520
     gtgcagcaca tgtgacaatg aaggacagat gtatcgcctt gatggttgtg gtgttggggt      2580
     cctgattcca gcattcatga gtcaggggaa ggtccctgct aaggacagac cttaggaggg      2640
     cagttggtcc aggacccaca cttgctttcc tcgtgtttcc tgatcctgcc ctgggtctgt      2700
     agtcatactt ctggaaattc cttttggttc caagacgagg aggttcctct aagatctcat      2760
     ggtcctgctt cctcccagtc ccctcacagg acattttctt cccacaggtg gaaaaggagg      2820
     gagctactct caggctgcgt gtaagtggtg ggggtgggag tgtggaggag ctcacccacc      2880
     ccataattcc tcctgtccca cgtctcctgc gggctctgac caggtcctgt ttttgttcta      2940
     ctccagccag cgacagtgcc cagggctctg atgtgtctct cacagcttga aaaggtgaga      3000
     ttcttggggt ctagagtggg tggggtggcg ggtctggggg tgggtggggc agtggggaaa      3060
     ggcctgggta atggagattc tttgattggg atgtttcgcg tgtgtcgtgg gctgttcaga      3120
     gtgtcatcac ttaccatgac taaccagaat ttgttcatga ctgttgtttt ctgtagcctg      3180
     agacagctgt cttgtgaggg accgagatgc aggatttctt cacgcctctc ctttgtgact      3240
     tcaagagcct ctggcatctc tttctgcaaa ggcacctgaa tgtgtctgcg tccctgttag      3300
     cataatgtga ggaggtggag agacagccca cccttgtgtc cactgtgacc cctgttcgca      3360
     tgctgacctg tgtttcctcc ccagaagctt gcggaagggc gaattccagc acactggcgg      3420
     ccgttactag tggatccgag ctcggtacca agcttgatgc a                          3461
//


spacer
spacer