spacer

EBI Dbfetch

ID   AJ310507; SV 2; linear; genomic DNA; STD; HUM; 3448 BP.
XX
AC   AJ310507;
XX
DT   17-MAR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele B*1801, exons 1-7
XX
KW   B*1801 allele; HLA-B gene; human leukocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Cox S.T.;
RT   ;
RL   Submitted (14-FEB-2001) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Confirmation of HLA-B*1801";
RL   Unpublished.
XX
RN   [3]
RP   1-3448
RA   Cox S.T.;
RT   ;
RL   Submitted (15-NOV-2004) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
DR   MD5; a74bf87634ead060b1ede126ca7b95ad.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3448
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(302..374,503..772,1019..1294,1867..2142,2247..2363,
FT                   2805..2837,2944..2987)
FT   CDS             join(302..374,503..772,1019..1294,1867..2142,2247..2363,
FT                   2805..2837,2944..2987)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801"
FT                   /product="human leukocyte antigen B"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P30466"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*18:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:4JQV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30466"
FT                   /protein_id="CAC34572.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FISVGYVDGTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            302..374
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801"
FT                   /number=1
FT   intron          375..502
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801"
FT                   /number=1
FT   exon            503..772
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801"
FT                   /number=2
FT   intron          773..1018
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801"
FT                   /number=2
FT   exon            1019..1294
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801"
FT                   /number=3
FT   intron          1295..1866
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801"
FT                   /number=3
FT   exon            1867..2142
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801"
FT                   /number=4
FT   intron          2143..2246
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801"
FT                   /number=4
FT   exon            2247..2363
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801"
FT                   /number=5
FT   intron          2364..2804
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801"
FT                   /number=5
FT   exon            2805..2837
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801"
FT                   /number=6
FT   intron          2838..2943
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801"
FT                   /number=6
FT   exon            2944..2987
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801"
FT                   /number=7
XX
SQ   Sequence 3448 BP; 643 A; 1008 C; 1080 G; 717 T; 0 other;
     tggtgtagga gaagagggat caggacgaag tcccaggccc cgggcggggc tctcagggtc        60
     tcaggctccg agagccttgt ctgcattggg gaggcgcagc attggggatt ccccactccc       120
     acgagtttca cttcttctcc caacctatgt cgggtccttc ttccaggata ctcgtgacgc       180
     gtccccattt cccactccca ttgggtgtcg ggtgtctaga gaagccaatc agtgtcgccg       240
     gggtcccagt tctaaagtcc ccacgcaccc acccggactc agaatctcct cagacgccga       300
     gatgcgggtc acggcgcccc gaaccctcct cctgctgctc tggggggcag tggccctgac       360
     cgagacctgg gctggtgagt gcggggtcgg cagggaaatg gcctctgtgg ggaggagcga       420
     ggggaccgca ggcgggggcg caggacccgg ggagccgcgc cgggaggagg gtcgggcggg       480
     tctcagcccc tccttgcccc aggctcccac tccatgaggt atttccacac ctccgtgtcc       540
     cggcccggcc gcggggagcc ccgcttcatc tcagtgggct acgtggacgg cacccagttc       600
     gtgaggttcg acagcgacgc cgcgagtccg aggacggagc cccgggcgcc gtggatagag       660
     caagaggggc cggagtattg ggaccggaac acacagatct ccaagaccaa cacacagact       720
     taccgagaga gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga       780
     ccccggcccg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       840
     agtctccggg tccgagatcc gcccccctga ggccgcggga cccgcccaga ccctcgaccg       900
     gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg       960
     gttggtcggg gcggggcggg gctcgggggg acggggctga ccgcggggcc ggggccaggg      1020
     tctcacaccc tccagaggat gtacggctgc gacgtggggc cggacgggcg cctcctccgc      1080
     gggcatgacc agtccgccta cgacggcaag gattacatcg ccctgaacga ggacctgagc      1140
     tcctggaccg cggcggacac cgcggctcag atcacccagc gcaagtggga ggcggcccgt      1200
     gtggcggagc agctgagagc ctacctggag ggcacgtgcg tggagtggct ccgcagacac      1260
     ctggagaacg ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc      1320
     ccatctccta taggtcgccg gggatggcct cccacgagaa gaggaggaaa atgggatcag      1380
     cgctagaatg tcgccctccc ttgaatggag aatggcatga gttttcctga gtttcctctg      1440
     agggccccct cttctctcta ggacaattaa gggatgacgt ctctgaggaa atggagggga      1500
     agacagtccc tagaatactg atcaggggtc ccctttgacc cctgcagcag ccttgggaac      1560
     catgactttt cctctcaggc cttgttctct gcctcacact cagtgtgttt ggggctctga      1620
     ttccagcact tctgagtcac tttacctcca ctcagatcag gagcagaagt ctctgttccc      1680
     cgctcagaga ctcgaacttt ccaatgaata gattatccca ggtgcctgcg tccaggctgg      1740
     tgtctgggtt ctgtgcccct tccccacccc aggtgtcctg tccattctca ggctggtcac      1800
     atgggtggtc ctagggtgtc ccatgagaga tgcaaagcgc ctgaattttc tgactcttcc      1860
     catcagaccc cccaaagaca catgtgaccc accaccccat ctctgaccat gaggccaccc      1920
     tgaggtgctg ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg      1980
     gcgaggacca aactcaggac accgagcttg tggagaccag accagcagga gatagaacct      2040
     tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga gcagagatac acatgccatg      2100
     tacagcatga ggggctgccg aagcccctca ccctgagatg gggtaaggag ggggatgagg      2160
     ggtcatatct cttctcaggg aaagcaggag cccttctgga gcccttcagc agggtcaggg      2220
     cccctcatct tcccctcctt tcccagagcc atcttcccag tccaccatcc ccatcgtggg      2280
     cattgttgct ggcctggctg tcctagcagt tgtggtcatc ggagctgtgg tcgctactgt      2340
     gatgtgtagg aggaagagct caggtaggga aggggtgagg ggtggggtct gggttttctt      2400
     gtcccactgg gggtttcaag ccccaggtag aagtgttccc tgcctcatta ctgggaagca      2460
     gcatccacac aggggctaac acagcctggg accctgtgtg ccagcactta ctcttttgtg      2520
     cagcacatgt gacaatgaag gacggatgta tcaccttgat ggttgtggtg ttggggtcct      2580
     gattccagca ttcatgagtc aggggaaggt ccctgctaag gacagacctt aggagggcag      2640
     ttggtccagg acccacactt gctttcctcg tgtttcctga tcctgccttg ggtctgtagt      2700
     catacttctg gaaattcctt ttggttccaa gacgaggagg ttcctctaag atctcatggc      2760
     cctgcttcct cccagtcccc tcacaggaca ttttcttccc acaggtggaa aaggagggag      2820
     ctactctcag gctgcgtgta agtggtgggg gtgggagtgt ggaggagctc acccacccca      2880
     taattcctcc tgtcccacgt ctcctgcggg ctctgaccag gtcctgtttt tgttctactc      2940
     cagccagcga cagtgcccag ggctctgatg tgtctctcac agcttgaaaa ggtgagattc      3000
     ttggggtcta gagtgggcgg gggggcgggg agggggcaga ggggaaaggc ctgggtaatg      3060
     gagattcttt gattgggatg tttcgcgtgt gtggtgggct gttcagagtg tcatcactta      3120
     ccatgactaa ccagaatttg ttcatgactg ttgttttctg tagcctgaga cagctgtctt      3180
     gtgagggacc gagatgcagg atttcttcac gcctcccctt tgtgacttca agagcctctg      3240
     gcatctcttt ctgcaaaggc acctgaatgt gtctgcgtcc ctgttagcat aatgtgagga      3300
     ggtggagaga cagctcaccc ccgtgtccac cgtgacccct gttcgcatgc tgacctgtgt      3360
     ttcctcccca gaagcttgcg gaagggcgaa ttccagcaca ctggcggccg ttactagtgg      3420
     atccgagctc ggtaccaagc ttgatgca                                         3448
//


spacer
spacer